KEGG   Hydrogenobaculum sp. HO: HydHO_1138Help
Entry
HydHO_1138        CDS       T02482                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
hho  Hydrogenobaculum sp. HO
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hho00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1051244..1052569
Genome map
AA seq 441 aa AA seqDB search
MKDAVVIGAGVSGIVAAYTLKKAGFDPLVIEKEPHIGGSTHTLREDGRIIELGVQSVLGQ
DEFMAFAKELNLKPLHPPKEHANTRYVYLNGQLKRMPSNPIEFLTSDFFSIFGKIRLLRE
PFIPPKDDLKESISDFVTRRLGKEFLDKIVEPFVCGIYAGDPDKLSAKYAVRRVKALEDE
YGSIIKGSMKKKALGPQGEITSFEGGLLTFLEKMASGIDISLENVALKITKKDDIYTIDT
KSGKIQTKSILIATPAYSASYLLRNLTWSMSAELDQIEYAPVIVISAIVKHTLPKGFGFL
IPRKENTIMLGALFSSNLFKICKEDENIITIYVGGERRKDVADWPEEKILSEVKKELKKI
LGIEDFEKYYFKKWKKAIPQYNIGYERFINTVKDIENMNKGVFIAGNYIEGNSFNDSLRY
AMKKANEQILFLKKGVAHAQV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgccgttgtaataggtgcaggtgttagtggaatagtagcagcttatacgctt
aaaaaagctggttttgatcctcttgttatagaaaaagagcctcacataggtggttctacc
catactttgagagaagatggccgtatcatagagcttggcgtacaatctgtgcttggccaa
gatgagtttatggcttttgccaaagaactaaatctaaaacctctacatccaccaaaagag
cacgccaacacaagatacgtatatttaaacggtcaacttaaaaggatgccatcaaacccg
attgagtttttaacctccgattttttttctatatttggtaaaatcaggcttttaagagag
ccatttataccaccaaaagacgatctcaaagaaagtataagcgattttgtaacaaggcgt
cttggtaaagagtttttggataagatagtagaaccctttgtatgcggtatatacgctgga
gacccggataagctgtctgccaaatacgccgttagaagggtaaaagccttagaagatgaa
tatgggtctatcataaaaggttctatgaagaaaaaagcccttggccctcaaggagagatc
acatcttttgaaggtgggcttttaacatttttagaaaaaatggcttctggcatagatata
tctttggaaaatgtggcacttaaaatcactaaaaaagatgatatatatactatagatact
aaaagcggtaaaattcaaacaaaatctatactaatagccacaccagcctacagtgcatct
tatcttcttagaaatctcacttggagcatgtctgcggaattagaccagatagagtatgca
cctgttatagtgataagtgctatcgtaaaacatacccttccaaagggttttgggttttta
ataccaagaaaagaaaataccatcatgcttggagcacttttttcaagcaatctatttaaa
atctgcaaagaagatgagaatattatcactatatatgtaggcggtgaaagaagaaaagat
gtagcagattggccagaggaaaagatattgtccgaagtgaaaaaagagcttaaaaaaatc
cttggtatagaggattttgaaaaatattatttcaaaaaatggaaaaaagccatacctcag
tacaacataggctacgagagatttataaacacagtaaaggatatagagaacatgaacaaa
ggtgtgtttatagcaggaaactatattgaaggtaattcttttaacgattctttaagatac
gccatgaaaaaagcaaacgaacagattttatttcttaaaaaaggagtggctcatgcacaa
gtttaa

DBGET integrated database retrieval system