KEGG   Hydrogenobaculum sp. HO: HydHO_1507Help
Entry
HydHO_1507        CDS       T02482                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
hho  Hydrogenobaculum sp. HO
Pathway
hho00521  Streptomycin biosynthesis
hho00523  Polyketide sugar unit biosynthesis
hho01130  Biosynthesis of antibiotics
Module
hho_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:hho00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    HydHO_1507
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HydHO_1507
Enzymes [BR:hho01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     HydHO_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AGG15815
UniProt: M1RUN5
Position
complement(1437055..1437627)
Genome map
AA seq 190 aa AA seqDB search
MPFEFIKTDIKEVILIKPKVFEDERGFFLESYKKSEFEENGITDVFIQDNHSKSVKGVLR
GLHYQKEPEAQGKLVRCIKGKIFDVAVDIRKNSPTYGKWVGYELSEENKLMLFIPKGFAH
GFLTLSEEAEVIYKVSGAEYSKEHDKGIIWNDKTINIKWPLEHIKEVILSDKDKNLPTLE
QADNNFLYGG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgagtttataaaaacagatataaaagaggtgatactgataaagccaaaggtc
tttgaagacgaaagagggtttttcttagaaagctataaaaaatctgagtttgaggaaaac
ggtataacagatgtctttatccaagataatcattcaaaatctgtaaaaggagtattaagg
ggccttcattatcaaaaagaaccagaagctcaaggaaagcttgtaagatgtataaagggt
aaaatatttgatgtggcagtagatataagaaaaaatagtcccacttacggcaaatgggta
ggatatgagctctcagaagaaaacaaactgatgctttttataccaaagggctttgcccat
ggatttttgaccctttcagaagaagctgaagtaatatacaaagtatctggggccgagtat
tcaaaagaacacgacaaaggtataatatggaacgataaaaccataaacataaaatggcct
ttagaacatataaaagaggttattttatctgataaagataaaaatctaccaacactagaa
caagcagacaacaactttttatacggaggataa

DBGET integrated database retrieval system