KEGG   Helicobacter pylori Shi112: HPSH112_01135Help
Entry
HPSH112_01135     CDS       T02037                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hhp  Helicobacter pylori Shi112
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hhp00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
223913..225019
Genome map
AA seq 368 aa AA seqDB search
MVVLGSTGSIGKNALKIAKKFKVGIEALSCGKNIALINEQIKVFKPKKVAILDPNDLNGL
EPLGAKVFVGLEGIDAMVEECVSNLVINAIVGVAGLRASFKSLQTNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGGAFRDTPLELIPIQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSIIA
HLASADMQLPISYAIDPKLASLSASIKPLDLYALSAIKFEPISMERYTLWRYKDLLLENP
KLGVVLNASNEVAMEKFLNQEIAFGGLIKTISQALESYAKTPFKLSNLDEVLALDREVRE
RFGNVARV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcaccggctctattgggaaaaacgccctaaaaatcgcaaaaaaa
ttcaaggtaggaatagaagccttaagctgtgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccaagaaagtggcgattttagatcctaacgatttgaatggttta
gagcctttgggcgcgaaagtgtttgtggggctagagggcattgatgcgatggtagaagag
tgcgtttcaaatttagtcattaacgccattgtgggcgtggctggattgagggcgagcttt
aaaagcttgcaaactaacaaaaaactagccctagcgaataaagaaagtttggtgagcgcg
gggcatttattagacatttcacaaatcacgcccattgatagcgagcattttggtttgtgg
gcgttgttgcaaaacaaggctttaaagcctaaatccttaatcattagcgcgagtgggggg
gctttcagggatacgcctttagaactcattcctattcaaaacgcgcaaaacgcgctcaag
caccctaattggagcatgggatctaaaatcactattgattcagcgagcatggtcaataag
ctttttgaaatcctagaaacctattggctttttggcgcgtctttaaagattgatgcgctg
attgaaaggagttctatcgtgcatgctttggtggagtttgaagataactctatcattgcg
catttggcgagcgcggacatgcaattacccataagctatgcgatcgatccgaagttagct
tctttgagcgcgtctatcaaacccttagatttatacgctttaagcgcgattaaatttgaa
cccattagcatggagcgctacactttgtggcgttataaagacttgttgttggaaaaccca
aagcttggcgtggtgctgaatgcgagcaatgaggtggcgatggagaagtttttaaatcaa
gagatcgcttttggtgggcttatcaaaaccatttctcaagccctagaatcatacgctaaa
acgcctttcaagctctctaatttagatgaagtgctggcgttggatagggaagttagggag
cggtttggaaatgtagcgagagtgtag

DBGET integrated database retrieval system