KEGG   Helicobacter pylori Shi112: HPSH112_01450Help
Entry
HPSH112_01450     CDS       T02037                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hhp  Helicobacter pylori Shi112
Brite
Enzymes [BR:hhp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HPSH112_01450
Secretion system [BR:hhp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HPSH112_01450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
289051..289848
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLIVSKDGNLVIGLGGIFFSNNAGDVKLLTETNQKILALNTNQQN
SAKLNAIFDEVPADYAIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINDQKEPEDLRTK
VENTTKKIFESGMIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatattccgcttatagtgagt
aaggatggtaatttagtcatagggcttggcggtatcttttttagcaataatgccggggat
gtgaagttgcttacagaaaccaatcaaaaaatcctagcccttaacaccaaccagcaaaat
agcgcgaaattgaacgctatttttgatgaagtgccagctgattatgcgatagagttgccc
tctactaacgctgaaaataaggataaaatcctttatattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagagatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggagtcaattcggctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctatccttgaaaag
atttattccacccaatacgatattaacgatcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcatgattaaaggtgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system