KEGG   Helicobacter pylori Shi112: HPSH112_03785Help
Entry
HPSH112_03785     CDS       T02037                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase subunit GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hhp  Helicobacter pylori Shi112
Pathway
hhp00040  Pentose and glucuronate interconversions
hhp00052  Galactose metabolism
hhp00500  Starch and sucrose metabolism
hhp00520  Amino sugar and nucleotide sugar metabolism
hhp01100  Metabolic pathways
hhp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPSH112_03785
   00052 Galactose metabolism
    HPSH112_03785
   00500 Starch and sucrose metabolism
    HPSH112_03785
   00520 Amino sugar and nucleotide sugar metabolism
    HPSH112_03785
Enzymes [BR:hhp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPSH112_03785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 P53_C Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AFI00958
Structure
PDB: 

Jmol
Position
complement(757051..757872)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMISLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctacggcacgcgctttttgccgattact
aaaaccattcctaaagaaatgctgcccattgtggataagcctttaatccaatacgctgta
gaagaagcgatggaagcaggctgtgaagtgatggcgattgttacaggcagaaacaagcgc
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccctaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggattagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcggtgattttagccgatgacttatgcataagccatgatcacccaagc
gtgctaaagcaaatgatttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcgctagaagaagtttcaaaatacggcgtgatcaggggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgctccaagcaat
ctagccgtgatagggcgctacattctaaccccggatatttttgaaattttaagcgagacg
aaaccgggcaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aaacggatcattgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttgtaa

DBGET integrated database retrieval system