KEGG   Helicobacter pylori Shi112: HPSH112_04805Help
Entry
HPSH112_04805     CDS       T02037                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hhp  Helicobacter pylori Shi112
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hhp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985499..986080
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKR
CASCNALSESEICEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHFHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaaatccgcttttaaaatggcgtatcatttgggtttagaaaac
ccctatctggcgctgaaaatcacgcacgctttagagaacgccctagaaaaccttaaaaga
tgtgcatcttgtaacgcgctcagtgagagtgaaatttgtgagatttgctctgatgagagc
cggcaaaattctcaactttgcatggttttacacccaagagatgtgtttattttagaagat
ttaaaggattttttagggcgctattatgtgttaaattctatagaagaagtggattttaac
gccctagaaaaacgcctgattgaagaaaacattaaagaaatcatttttgctttccctccc
actttggctaatgattctttaatgctttatattgaagataaattgcaacatttccacctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactca
gtttcgctctcaagggcgtttaattcaaggatcaaagcatga

DBGET integrated database retrieval system