KEGG   Helicobacter pylori Shi112: HPSH112_05490Help
Entry
HPSH112_05490     CDS       T02037                                 

Gene name
porD
Definition
pyruvate flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
hhp  Helicobacter pylori Shi112
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPSH112_05490 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH112_05490 (porD)
   00020 Citrate cycle (TCA cycle)
    HPSH112_05490 (porD)
   00620 Pyruvate metabolism
    HPSH112_05490 (porD)
   00640 Propanoate metabolism
    HPSH112_05490 (porD)
   00650 Butanoate metabolism
    HPSH112_05490 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPSH112_05490 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSH112_05490 (porD)
Enzymes [BR:hhp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSH112_05490 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1133529..1133921
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVSKPVHNNSICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIDPASALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgca
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtgtctaagcctgtgcataacaatagcatttgcatcaac
tgctttaattgttgggtttattgcccagatgctgctattctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgtgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgatcctgctagcgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcgtaa

DBGET integrated database retrieval system