KEGG   Helicobacter pylori Shi112: HPSH112_05500Help
Entry
HPSH112_05500     CDS       T02037                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hhp  Helicobacter pylori Shi112
Pathway
hhp00010  Glycolysis / Gluconeogenesis
hhp00020  Citrate cycle (TCA cycle)
hhp00620  Pyruvate metabolism
hhp00640  Propanoate metabolism
hhp00650  Butanoate metabolism
hhp00680  Methane metabolism
hhp01100  Metabolic pathways
hhp01120  Microbial metabolism in diverse environments
hhp01130  Biosynthesis of antibiotics
hhp01200  Carbon metabolism
Module
hhp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH112_05500
   00020 Citrate cycle (TCA cycle)
    HPSH112_05500
   00620 Pyruvate metabolism
    HPSH112_05500
   00640 Propanoate metabolism
    HPSH112_05500
   00650 Butanoate metabolism
    HPSH112_05500
  Energy metabolism
   00680 Methane metabolism
    HPSH112_05500
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSH112_05500
Enzymes [BR:hhp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSH112_05500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: AFI01293
Position
1135167..1136111
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPSGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFESNKTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgaaaaattccaaggc
tcgcacttgctttgtccgggttgcgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggcggtg
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaatggctctacg
gcgatttcaggggtggaagcgatgtataaagcgctagtgaataagggccgctatcaaggt
caaaaaccaaaatttgtggcgtttgggggcgatggggccagttatgatattggtttgcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcctagataatgaa
aactacgccaataccggcggtcaaagaagcggctctacgccattaggggctagcacttct
accacgccatcaggatcggttagctttggtaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggagtcccttatgtggcgcagctctcgcctaacaaatggaaagac
atgaacaaaaagattaaaaccgcgctagacactgaagggccttgcttcatcaacgctctt
agcccatgcacgactgaatggaaatttgaatccaataaaaccattgaattagcggatatg
gctgtggatagcttgatgttccccctatttgaaatctttaatggcagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaagcgcttc
aaacaccttttcaaaaaagaaaacgaacacattattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaggctaaagtataa

DBGET integrated database retrieval system