KEGG   Helicobacter pylori Shi112: HPSH112_06135Help
Entry
HPSH112_06135     CDS       T02037                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hhp  Helicobacter pylori Shi112
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPSH112_06135
Enzymes [BR:hhp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HPSH112_06135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1266480..1267622
Genome map
AA seq 380 aa AA seqDB search
MILKRLNPDALKNALLKTGSEKCAQTHMHKKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLIVSASQLERLIVKCHSQPFGLKNLAQELKSHLKSQKPNAPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQLLEKGITLIDIGAASSRPQSEIIDPKIEQDR
LKEILLEIKSQKLYQCAKFSIDTYHATTAQMALEHYFSILNDVSGFSSIGMLEVARDYKP
TCILMHTQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKHALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRV
HDIDEHIDLIKVFKSLEETN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaaacgccttaacccggatgcgctcaaaaacgcccttttaaaaaccggatca
gaaaaatgcgctcaaacccatatgcataaaaaaggcgttagctttgtttttgaaatccaa
catctgcccttaagcgcaacgctgattttaaaacaagaggccatcagcgttgggggcgat
ttcgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgctgatt
gtgagcgctagccagttagaacgccttattgtcaagtgccattcccaaccctttgggctt
aaaaatttagcgcaagaattaaaaagccaccttaaatcccagaaacctaacgccccacag
atcatggcaattttgaatctcacgccggatagtttttatgaaaaaagccggtttgatagt
aaaaaagcgcttgaagaaatctatcaattattagaaaagggtatcacgctcattgatata
ggcgcggccagttcaaggccacagagtgaaatcattgatccaaaaatagaacaagatcgc
ttaaaagaaattttattagaaatcaaatcccaaaaactctaccaatgcgctaaattcagc
atagacacctaccatgccacaaccgcccaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttagtagtattggaatgctagaagtcgccagagattacaagccc
acttgcattttaatgcacactcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatctgtttgatgaaatggatcgcttctttaaggaaaaactagaggttttagaaaaa
cacgcgcttcaagatattattttagatatagggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccacttcctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gccggcactttgagtttgcatttaatggcgctacaaaatggagcgagcattttaagagtg
catgacattgatgagcatatagatctcatcaaggtgtttaagagtttggaagaaacaaat
tga

DBGET integrated database retrieval system