KEGG   Helicobacter pylori Shi112: HPSH112_06405Help
Entry
HPSH112_06405     CDS       T02037                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hhp  Helicobacter pylori Shi112
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSH112_06405 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSH112_06405 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSH112_06405 (trpA)
Enzymes [BR:hhp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSH112_06405 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1316954..1317742)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQEKMAFIPFVTLGDPNYALSFEIVKTLIASGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLRAIRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASNKDLEQAAMHSQGYIYTLARSGV
TGVSRILENDASAIIKTLKTFSPTPALLGFGISKKEHIKNAKGMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFIGEMIS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagaaaaaatggcgtttatccca
tttgtaaccttgggcgatcctaattatgcattgagttttgaaatcgttaaaactttaatt
gctagcggggtgagcgctttagaattggggtttgctttctctgatccggtagcggatggc
gttaccatacaagcgagccatttaagagcgttaaaacacgctagcatggctaaaaatttc
cagcttttaagggcgatcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggacatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccagattaaacaaatctttatcgccagtcccaatgcgagtaataaagat
ttagaacaagccgctatgcattcgcagggctatatctacactctggctaggagtggggtt
acaggagtgagccgtattttagaaaatgacgcgagcgctattattaaaaccttaaaaacc
tttagtcctacccccgccttattgggctttggcatttctaaaaaagaacacatcaaaaac
gctaaaggcatgggcgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgctggaaaaaattaaagggtttataggagaaatg
atctcttaa

DBGET integrated database retrieval system