KEGG   Helicobacter pylori Shi112: HPSH112_07305Help
Entry
HPSH112_07305     CDS       T02037                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hhp  Helicobacter pylori Shi112
Pathway
hhp00900  Terpenoid backbone biosynthesis
hhp01100  Metabolic pathways
hhp01110  Biosynthesis of secondary metabolites
hhp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSH112_07305
Enzymes [BR:hhp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPSH112_07305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFI01642
Position
1487771..1488574
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKFKDIISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSAIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSSEELYSMGSLVGTDTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYAPN
HVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTCDRNELNDLLKPALLTNQALRDIE
SELGKEWFFSGSGSAFFRLKPALKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcttttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaagaa
ggggcttaccataagctcatttctcgcatgtgtttggtcaaagataaattcaaagatatt
atcagcgtcaaaagcgcgctttccttttcgctaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgccatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccgggttaggcggtgggagcgctgatgctggggggctattgtatcatctgaat
caaatttttgactggcgtttgagttcagaagagctttatagcatgggatctttagtgggc
acagacaccaattttttcatctcgcaacacaaaagtgctaacgccacttcttacggcgaa
gttattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcgccaaac
catgttttttgcagcaccaaagctatttatcaagcctataagcctgaaacttgtttttct
caagctaaagagtggcttaaaaaaccgagtttagaatgcctaaagacttgcgacagaaac
gaattaaacgatcttttaaagccggctttactcactaaccaagccttaagagatatagaa
agcgaattaggcaaggagtggttttttagcgggagcgggagcgcgttttttaggctaaag
cctgcgttaaaagggggcgaatga

DBGET integrated database retrieval system