KEGG   Helicobacter pylori Shi112: HPSH112_07400Help
Entry
HPSH112_07400     CDS       T02037                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hhp  Helicobacter pylori Shi112
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1505384..1506436
Genome map
AA seq 350 aa AA seqDB search
MKKSILLGVCLAFSCAHALNDLELIKKARESQLEPMPMGKALKEYQIKKTKDVGIGTKNS
EIMTPAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAVGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFEALKGKKPKILYPELPVMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttattgggcgtttgcttggctttttcttgcgcccatgccttgaac
gatttagaactgatcaaaaaagcgagggaaagccaattagagcctatgcctatgggcaaa
gcgctcaaagaataccagattaaaaaaactaaagatgtgggtattggcaccaaaaacagc
gagattatgacccccgctcaagtggaattaggcaaaatgctctactttgatcctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataatttgggcttaggcggggtggat
ttagtcccaagcgctgtaggttctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactctgtgtttaacgatgtgcagttttgggatgggagggttacgcattta
aacgaacaagcgcaagggcccatccagtcttcttttgaaatgggggctgatccaaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaaactctttagaaaagcttatggc
tccaaagtcaaaattgattttaaattgatcgcagatagtatcgctatgtttgaagccacg
cttatcaccccaagccgttatgatgattttttaagaggcaatcctaaagcgctcagtaaa
gccgaaaaagaagggctggatttattcatttctaaaggctgtgtggcttgccataacggc
attaatcttgggggaacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaatgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcaattttgggatgtcaaggatgcaattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
actttctttgaagccttaaagggtaaaaaaccgaaaatactctatccagaactccctgta
atgacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system