KEGG   Helicobacter pylori Shi112: HPSH112_07780Help
Entry
HPSH112_07780     CDS       T02037                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hhp  Helicobacter pylori Shi112
Pathway
hhp00220  Arginine biosynthesis
hhp00330  Arginine and proline metabolism
hhp01100  Metabolic pathways
hhp01110  Biosynthesis of secondary metabolites
hhp01130  Biosynthesis of antibiotics
hhp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hhp00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPSH112_07780
   00330 Arginine and proline metabolism
    HPSH112_07780
Enzymes [BR:hhp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPSH112_07780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFI01735
Structure
PDB: 

Jmol
Position
complement(1593110..1594078)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTIVQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEVDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFNELKQLLGLLLESFKDRLKAVEVTEYNPTVSAKHTNEEERQVLE
ILDLIINSCKIKDKKPSFIMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcactgataaaggg
gttaggcgtttgagagaagccttaagcgcaacgcatggcgatgtgattaaaggcatgcaa
acgatcgttcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttgggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaagttgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaattattaaaagcggtggatattatttaccttagtctagatttagatattatggatggc
aagcttttcacttctactggcgtgcgtgaaaataacgggctgagttttaatgagttgaag
caattactgggcttgcttttagaaagctttaaagacagattaaaagccgttgaggtaacc
gaatataaccccacggtgagtgcaaaacacaccaacgaagaagaaaggcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagccatcttttataatg
agtcgctga

DBGET integrated database retrieval system