KEGG   Helicobacter pylori Shi169: HPSH169_00470Help
Entry
HPSH169_00470     CDS       T02038                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hhq  Helicobacter pylori Shi169
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hhq01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hhq00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:hhq00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(90591..92051)
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFEMLEWQDCLNLSYNELVECVFERL
GLEIPNGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNSTLKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERVLFDLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAKHQYLIDPHTATALNASLKTHEKTLVSATASYEKFP
STTLLALNEQKKNDNDKTALETLKNSYNTPNSQRLDDLFERGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgttctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgccccaaaaggcgggctttacactttagagcattttgaaatgttagaa
tggcaggattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcggttg
gggttagagattcctaatggtttattaacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaaatatttaatgctcgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacagcactttaaaagcgcgccaattaaaattaagcgtg
gctaattccgtgaattttgggcgcatcgctttccaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgccttaggagcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaagcaaacttactcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttgatctctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttacgcactaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaacaatccaa
gaagtttatgcaaagcaccaatacctgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaactcatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattcccc
agcaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaacaccccaaatagccagcgtcttgatgatttatttgaa
agaggaatcaagcaccaagaggttttaaaactcaatgagatcaaatcttctatccttttg
tggctagaaaacacgcattaa

DBGET integrated database retrieval system