KEGG   Helicobacter pylori Shi169: HPSH169_01245Help
Entry
HPSH169_01245     CDS       T02038                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hhq  Helicobacter pylori Shi169
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hhq00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
249102..250208
Genome map
AA seq 368 aa AA seqDB search
MVVLGSTGSIGKNALKVAKKFKVGIEALSCGKNIALINEQIKVFKPKKVAILDPNDLNGL
EPLGAKVFVGLEGIDAMIEECVSNLVINAIVGVAGLRASFKSLQTNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGGAFRDTPLELIPIQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSIIA
HLARADMQLPISYAINPKLASLSASIKPLDLYALSAIKFEPISMERYTLWRYKDLLLENP
KLGVVLNASNEVAMEKFLNQEIAFGGLIKTISQALESYAKTPFKLSDLDEVLALDREVRE
RFGSVARV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcaccggctctattgggaaaaacgccctaaaagtcgcaaaaaaa
ttcaaggtaggaatagaagccttgagctgtgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccaagaaagtggcaattttagatcctaacgatttgaatggttta
gagcctttgggcgcgaaagtgtttgtagggctagagggcattgatgcgatgatagaagag
tgcgtttcaaatttagtcattaacgccattgtgggcgtggctggattgagggcgagcttt
aaaagcttgcaaactaacaaaaaactagccctagcgaataaagaaagcttggtgagcgcg
gggcatttattagacatttcacaaatcacgcccattgatagcgagcattttgggttgtgg
gcgttgttgcaaaacaaggctttaaagcctaaatccttaatcattagtgcgagtgggggg
gctttcagggacacgcctttagaactcattcctattcaaaacgcgcaaaacgcgctcaag
caccctaattggagcatgggatctaaaatcactattgattcagcgagcatggtcaataag
ctttttgaaatcctagaaacctattggctttttggcgcgtctttaaagattgatgcactg
attgaaaggagttctatcgtgcatgctttggtggagtttgaagataactctatcattgcg
catttggcaagagcggacatgcaattgcccataagctatgccattaaccctaaattagcc
tctttgagcgcgtctatcaaacccttagatctatacgctttaagtgcgattaaatttgaa
cccattagcatggagcgctacactttgtggcgttataaagacttgttgttggaaaaccca
aagcttggcgtggtgctgaatgcgagcaatgaggtggcgatggagaagtttttaaatcaa
gagatcgcttttggtgggcttatcaaaaccatttctcaagccctagaatcatacgctaaa
acgcctttcaagctctctgatttagatgaagtgctggcgttggatagggaagttagggag
cgttttggaagtgtagcgagagtgtag

DBGET integrated database retrieval system