KEGG   Helicobacter pylori Shi169: HPSH169_01325Help
Entry
HPSH169_01325     CDS       T02038                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hhq  Helicobacter pylori Shi169
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265708..266505
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLIVSKDGNLVIGLGGIFFSNNAGDVKLLTETNQKILALNTNQQN
SAKLNAIFDEVPADYAIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINDQKEPEDLRTK
VENTTKKIFESGMIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatattccgcttatagtgagt
aaggatggtaatttagtcatagggcttggcggtatcttttttagcaataatgccggggat
gtgaagttgcttacagaaaccaatcaaaaaatcctagcccttaacaccaaccagcaaaat
agcgcgaaattgaacgctatttttgatgaagtgccagctgattatgcgatagagttgccc
tctactaacgctgaaaataaggataaaatcctttatattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagagatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggagtcaattcggctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctatccttgaaaag
atttattccacccaatacgatattaacgatcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcatgattaaaggtgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system