KEGG   Helicobacter pylori Shi169: HPSH169_02245Help
Entry
HPSH169_02245     CDS       T02038                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hhq  Helicobacter pylori Shi169
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPSH169_02245
Enzymes [BR:hhq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPSH169_02245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448315..448806
Genome map
AA seq 163 aa AA seqDB search
MMREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
VYINPPFGYMKQPNFYNATIILKTSLSLHHFFALVFYIERRFGRQRKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHPKWSERDSVLVPLALQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactagccgcttcttccctagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggctgggatctaatcttaaaaatcctttaaaaatatta
aaaaattgttttttatattttaaaaatcatagtaaaatcgggaaaattttttcttcgcct
gtttatatcaacccgccttttggttacatgaagcaacctaacttttataacgctacgatt
atccttaaaacatctttaagtttgcaccattttttcgctctggttttttatatagaaagg
cgttttgggcgccaaaggaagcgcgattttaaagacgctccaagaactttagacattgat
attatcgctttcaatcaagtcattttaagacagaatgatttgactttacctcatcctaaa
tggagtgaaagggattcggtgttagtgccgttggctttgcaacaaattctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system