KEGG   Helicobacter pylori Shi169: HPSH169_05470Help
Entry
HPSH169_05470     CDS       T02038                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00010  Glycolysis / Gluconeogenesis
hhq00020  Citrate cycle (TCA cycle)
hhq00620  Pyruvate metabolism
hhq00640  Propanoate metabolism
hhq00650  Butanoate metabolism
hhq00680  Methane metabolism
hhq01100  Metabolic pathways
hhq01120  Microbial metabolism in diverse environments
hhq01130  Biosynthesis of antibiotics
hhq01200  Carbon metabolism
Module
hhq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH169_05470
   00020 Citrate cycle (TCA cycle)
    HPSH169_05470
   00620 Pyruvate metabolism
    HPSH169_05470
   00640 Propanoate metabolism
    HPSH169_05470
   00650 Butanoate metabolism
    HPSH169_05470
  Energy metabolism
   00680 Methane metabolism
    HPSH169_05470
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSH169_05470
Enzymes [BR:hhq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSH169_05470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AFH99760
UniProt: A0A0E0WEG1
Position
1132533..1133093
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDNEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagcgggtcaaggcgctatcaccggcgctaaaggg
ctggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggggctgctatgatggcttataaccgcattgataatgagcctattttaaac
catgaacgcttcatgcagcctgattatgtgctggtgattgatccgggtttggttttcatt
gaaaacatcttcgctaatgaaaaagaagacacgacctatatcatcactagctatcttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccctatccctaacacgcccatgctaggg
gcgttaatgaaagtgtctggcatgcttgaaatcggggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system