KEGG   Helicobacter pylori Shi169: HPSH169_06120Help
Entry
HPSH169_06120     CDS       T02038                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hhq  Helicobacter pylori Shi169
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hhq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1265508..1266650
Genome map
AA seq 380 aa AA seqDB search
MILKRLNPDALKNALLKTGSEKSAQTHMHKKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLIVSASQLERLIVKCHSQPFGLKNLAQELKSHLKSQKPDNPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQLLEKGITLIDIGAASSRPQSETIDPKIEQDR
LKEVLLEIKSQKLYQCAKFSIDTYHATTAQMALEHYFSILNDVSGFSSIGMLEVAKDYKP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKHALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRV
HDIDEHIDLIKVFKNLEETN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaaacgccttaaccctgatgcactcaaaaacgcccttttaaaaaccggatca
gaaaaatccgctcaaacccatatgcataaaaaaggcgttagctttgtttttgaaatccaa
catctgcccttaagcgcaacgctcattttaaaacaagaggccatcagcgttgggggcgat
ttcgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgctgatt
gtgagcgctagccagttagaacgccttattgtcaagtgccactcccaaccctttgggctt
aaaaatttagcgcaagaattaaaaagccatcttaaatcccagaagcctgacaacccacag
atcatggcaattttgaatctcacgccggatagtttttatgaaaaaagccggtttgatagc
aaaaaagcgcttgaagaaatctatcaattattagaaaagggtatcacgctcattgatata
ggcgcggccagttcaaggccacagagtgaaaccattgatccaaaaatagagcaagatcgc
ttaaaagaagttttattagaaatcaaatcccaaaaactctaccaatgcgctaaattcagc
atagacacctaccatgccacaaccgcccaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttagcagtattggaatgctagaagtcgcaaaagattacaagccc
acttgcattttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatctgtttgatgaaatggatcgcttctttaaggaaaaactagaggttttagaaaaa
cacgcgctccaagatattattttagatatagggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccacttcctcaaattcaaaaaacccttattagtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gctggcactttaagcttgcatttaatggcgttacaaaatggagcgagcattttaagagtg
catgacattgatgagcatatagatctcatcaaggtgtttaagaatttagaagaaacaaat
tga

DBGET integrated database retrieval system