KEGG   Helicobacter pylori Shi169: HPSH169_06345Help
Entry
HPSH169_06345     CDS       T02038                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00010  Glycolysis / Gluconeogenesis
hhq00030  Pentose phosphate pathway
hhq00051  Fructose and mannose metabolism
hhq00052  Galactose metabolism
hhq00230  Purine metabolism
hhq00500  Starch and sucrose metabolism
hhq00520  Amino sugar and nucleotide sugar metabolism
hhq00521  Streptomycin biosynthesis
hhq01100  Metabolic pathways
hhq01110  Biosynthesis of secondary metabolites
hhq01120  Microbial metabolism in diverse environments
hhq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH169_06345
   00030 Pentose phosphate pathway
    HPSH169_06345
   00051 Fructose and mannose metabolism
    HPSH169_06345
   00052 Galactose metabolism
    HPSH169_06345
   00500 Starch and sucrose metabolism
    HPSH169_06345
   00520 Amino sugar and nucleotide sugar metabolism
    HPSH169_06345
  Nucleotide metabolism
   00230 Purine metabolism
    HPSH169_06345
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPSH169_06345
Enzymes [BR:hhq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPSH169_06345
    5.4.2.8  phosphomannomutase
     HPSH169_06345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFH99931
UniProt: A0A0E0WDM7
Position
1309937..1311313
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSTFSIGVELGKIMREYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPKKANALEAYQRYLIKDFEHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAISIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYDTINAFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQETLKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKKVLLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttaccccaccactttagat
gaaaagagcacctttagtatcggcgtggagttagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgatcgctttttgaagctttgagc
gccgggttacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagacaacatccaatgccccaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccaaagaaagccaatgccctagaagcgtatcagcgctatttg
atcaaggattttgagcatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggattagagcctattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctcccatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtatgacacgattaacgcttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgttattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaagaaacgcttaaaaacccgccaagtcat
ttccctaaaatcaaagaaataatcagcattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagaatataaaaaagtgctactcaatttgctagagaaataa

DBGET integrated database retrieval system