KEGG   Helicobacter pylori Shi169: HPSH169_06350Help
Entry
HPSH169_06350     CDS       T02038                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00260  Glycine, serine and threonine metabolism
hhq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hhq01100  Metabolic pathways
hhq01110  Biosynthesis of secondary metabolites
hhq01130  Biosynthesis of antibiotics
hhq01230  Biosynthesis of amino acids
Module
hhq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSH169_06350 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSH169_06350 (trpA)
Enzymes [BR:hhq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSH169_06350 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AFH99932
UniProt: A0A0E0WCA0
Position
complement(1312018..1312806)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQDKMAFIPFVTLGDPNYEWSFEIIKTLIASGVSALELGFAFSDPVADG
VTIQASHLRALKHATMAKNFQLLRAIRDCNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASNKDLEQAAMHSQGYIYTLTRSGV
TGASRILENDASAIIKTLKTFSPTPALLGFGISKKEHIKNAKGMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFIGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagatataaaaacatgtttgaaacattaaaaaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaatggagttttgaaatcattaaaactttaatt
gctagcggggtgagcgctttagaattggggtttgctttctccgatccggtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacacgctactatggctaaaaatttc
cagctcttaagggcgatcagagattgcaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccagattaaacaaatctttatcgctagccccaatgcgagtaataaagat
ttagaacaagccgctatgcattcgcaaggctatatctacactctgactagaagtggggtt
acaggagcgagccgtattttagaaaatgacgcgagcgctattattaaaaccttaaaaact
tttagccccacaccggccttattaggctttggcatttctaaaaaagaacacataaaaaac
gctaaaggcatgggtgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgctggaaaaaattaaggggtttataggagaaatg
atcttttaa

DBGET integrated database retrieval system