KEGG   Helicobacter pylori Shi417: HPSH417_00805Help
Entry
HPSH417_00805     CDS       T02039                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hhr  Helicobacter pylori Shi417
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hhr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(160724..161695)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMIRETRLNIDDFIAPLFVIESDSYIKNEINSMPGVYQMSVEPLL
KECEELVGLGIKAVLLFGIPKHKDATGSHALNKDHIVAKAAREVKKRFKDLIVIADLCFC
EYTDHGHCGILENASVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKTLDNA
GYTHTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYANKKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEMANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaacttaagagcgatgataagagaa
acgcgtctgaatattgatgatttcatcgctcccttatttgtcatagaaagcgatagttat
attaaaaatgagatcaactccatgcctggcgtttatcaaatgagtgtagagcctctttta
aaagaatgcgaagaattagtgggtttaggcatcaaagccgttttattgtttggcattcct
aaacataaggacgccacaggaagccatgcgttaaataaggatcacattgtcgcaaaagcc
gctagagaggttaaaaaacgattcaaggatttaatcgttatagcggatttgtgtttttgt
gaatacaccgaccatgggcattgcgggattttagaaaacgcttctgtgtctaacgataaa
acgctagagattttaaaccttcaagggcttattttggctgaaagcggtgtggatattcta
gccccaagcaacatgatggatgggaatgttttaagcttgagaaaaacgctagataacgcc
ggctatacccacacgcccatcatgagctattccactaaatttgcgagcagttactatggg
ccttttagagatgtggcaaactctgcgccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaataaaaaagaagcgcttttagaaagtttagaagatgaaaaacagggtgcg
gatattttaatggtgaaaccggctttggcgtatttggatattgttaaagaaatcagagat
cacactttgctccctttagcgctctataatgtgagcggggaatacgccatgctcaaactc
gctcaaaaacacaatctgatcaactatgaaagcgttttattagaaacgatgacttgtttt
aaaagagcgggagcggatatgattattagctatcatgctaaagaaatggctaacttatta
caaaggaattga

DBGET integrated database retrieval system