KEGG   Helicobacter pylori Shi417: HPSH417_04490Help
Entry
HPSH417_04490     CDS       T02039                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hhr  Helicobacter pylori Shi417
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hhr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HPSH417_04490 (recR)
DNA repair and recombination proteins [BR:hhr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HPSH417_04490 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
924201..924782
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CASCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHFHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaaatccgcttttaaaatggcgtatcatttgggtttagaaaac
ccctatctggcgctgaaaatcacgcacgctttagagaacgccctagaaaaccttaaaaca
tgtgcatcttgtaacgcgctcagtgagagtgaagtttgtgagatttgctctgatgagagc
cggcaaaattctcagctttgcatggttttacacccaagagatgtgtttattttagaggat
ttaaaggattttttagggcgctattatgtgttaaattctatagaagaagtggattttaac
gccctagaaaaacgcctgattgaagaaaacattaaagaaatcatttttgctttccctccc
actttggctaatgattctttaatgctttatattgaagataaattgcagcatttccacctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactca
gtttcgctctcaagggcgtttaattcaaggattaaagcatga

DBGET integrated database retrieval system