KEGG   Helicobacter pylori Shi417: HPSH417_05145Help
Entry
HPSH417_05145     CDS       T02039                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hhr  Helicobacter pylori Shi417
Brite
Enzymes [BR:hhr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HPSH417_05145 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 NodS Peptidase_S24 Methyltransf_32 Methyltransf_4 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: AFH98162
Position
1074884..1075513
Genome map
AA seq 209 aa AA seqDB search
MKSIKNHLMCEEINKRFSLHPKVREAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYIEARLRLKTL
GLNNVHVKFADGNKGWDQYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALHVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaagagtattaaaaaccatttgatgtgtgaagaaatcaataagcgtttcagtttgcac
ccaaaagtgagagaggctatggagagcattgaaagggaagtttttgtgccagcccctttt
aaacattttgcttacactttaaacgctctttctatgcaagcgcaacaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaattgatcatgtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggtgctttctcaaattttcaggcgcgtt
tttagcattgaaaggattgaaagcttgtatatagaagcgcgtttgcgccttaaaactctc
ggtttaaacaacgttcatgttaaattcgctgatgggaataagggctgggatcaatacgcc
ccctatgataggattttattctctgcttgcgctaaaaatatccctcaagcgctgattgat
cagcttgaagaaggtgggatattagtcgcacccattcaagaaaataacgagcaagtgatc
aaacgctttgtgaagcaaaataacgccttgcacgtccaaaaagtgttagaaaaatgcttg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system