KEGG   Helicobacter pylori Shi417: HPSH417_05205Help
Entry
HPSH417_05205     CDS       T02039                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hhr  Helicobacter pylori Shi417
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPSH417_05205 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH417_05205 (glk)
   00052 Galactose metabolism
    HPSH417_05205 (glk)
   00500 Starch and sucrose metabolism
    HPSH417_05205 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPSH417_05205 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPSH417_05205 (glk)
   00524 Butirosin and neomycin biosynthesis
    HPSH417_05205 (glk)
Enzymes [BR:hhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPSH417_05205 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1086775..1087785
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLDLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcacgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagtcttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgactaacaaccattggactttttctattgaaacgacacggcaatgtttggatttaaaa
aaattgcttgtcatcaacgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaacagcgacggctctttaaaa
gtcttgcccggtgaaggggggcatgtgagcttcgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcagaaaggtttttgagcggg
agcggtttggtgctgatttatgaagccctatctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatcccg
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactccgggactt
gatggggcaggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system