KEGG   Helicobacter pylori Shi417: HPSH417_05235Help
Entry
HPSH417_05235     CDS       T02039                                 

Definition
pyruvate flavodoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hhr  Helicobacter pylori Shi417
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:hhr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hhr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hhr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hhr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hhr00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hhr00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:hhr00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1093954..1094514
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDNEPILN
HERFMQPDYVLVIDPGLVFIENIFADEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagcgggtcaaggcgctatcaccggcgctaaaggg
ctggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggagctgctatgatggcttataaccgcattgataatgagcctattttaaac
catgaacgcttcatgcagcctgattatgtgctggtgattgatccgggtttggttttcatt
gaaaatatcttcgctgatgaaaaagaagacacgacctatatcatcaccagctatcttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccccatccctaacacgcccatgctaggg
gcgttaatgaaagtgtctggcatgcttgaaatcggggcttttaaagaagcttttaagaaa
gttttgggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system