KEGG   Helicobacter pylori Shi417: HPSH417_05240Help
Entry
HPSH417_05240     CDS       T02039                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hhr  Helicobacter pylori Shi417
Pathway
hhr00010  Glycolysis / Gluconeogenesis
hhr00020  Citrate cycle (TCA cycle)
hhr00620  Pyruvate metabolism
hhr00640  Propanoate metabolism
hhr00650  Butanoate metabolism
hhr00680  Methane metabolism
hhr01100  Metabolic pathways
hhr01120  Microbial metabolism in diverse environments
hhr01130  Biosynthesis of antibiotics
hhr01200  Carbon metabolism
Module
hhr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH417_05240 (porD)
   00020 Citrate cycle (TCA cycle)
    HPSH417_05240 (porD)
   00620 Pyruvate metabolism
    HPSH417_05240 (porD)
   00640 Propanoate metabolism
    HPSH417_05240 (porD)
   00650 Butanoate metabolism
    HPSH417_05240 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPSH417_05240 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSH417_05240 (porD)
Enzymes [BR:hhr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSH417_05240 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_9 Fer4_17 Fer4_15 Fer4_7 Fer4_16 Fer4_8 Fer4_4 Fer4_13 Fer4_18 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFH98180
Position
1094530..1094922
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIELASALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgcg
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctatttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataacatttgcatcaac
tgctttaattgttgggtttattgcccagatgctgctattctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgtgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgagcttgctagtgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system