KEGG   Helicobacter pylori Shi417: HPSH417_05245Help
Entry
HPSH417_05245     CDS       T02039                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hhr  Helicobacter pylori Shi417
Pathway
hhr00010  Glycolysis / Gluconeogenesis
hhr00020  Citrate cycle (TCA cycle)
hhr00620  Pyruvate metabolism
hhr00640  Propanoate metabolism
hhr00650  Butanoate metabolism
hhr00680  Methane metabolism
hhr01100  Metabolic pathways
hhr01120  Microbial metabolism in diverse environments
hhr01130  Biosynthesis of antibiotics
hhr01200  Carbon metabolism
Module
hhr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH417_05245 (porA)
   00020 Citrate cycle (TCA cycle)
    HPSH417_05245 (porA)
   00620 Pyruvate metabolism
    HPSH417_05245 (porA)
   00640 Propanoate metabolism
    HPSH417_05245 (porA)
   00650 Butanoate metabolism
    HPSH417_05245 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPSH417_05245 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSH417_05245 (porA)
Enzymes [BR:hhr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSH417_05245 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AFH98181
Position
1094932..1096155
Genome map
AA seq 407 aa AA seqDB search
MARSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAGGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMNASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLRGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagtattgaattacaagagatagaagtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattacggctcgtttaaggataatggctatattgatggcgaatttgtt
ttagtggaatctgagcatgccgccatgagtgcatgcgtgggagctgcagctggtggtgga
agggttagcactgcgactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgcgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttaagcagggattctggctggataagt
ttatgcacatgcaacccccaagaagcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcccactattgtcaatcaagacgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttaccaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgaacgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcaccggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggcgacc
atccattccttacgccccttcccttatgaaagattagggcaggatttgaaaaaccttaaa
gcattagcgattttagataagagctctccagcgggtgctatgggagcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccccgtagtgtctaactatatc
tatggtttaggcgaaagggatatgacaatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcgt
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system