KEGG   Helicobacter pylori Shi417: HPSH417_06000Help
Entry
HPSH417_06000     CDS       T02039                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hhr  Helicobacter pylori Shi417
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPSH417_06000 (hemD)
Enzymes [BR:hhr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HPSH417_06000 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258756..1259436
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLK
ILQNIPAYALSEPTAKTLQDHHFKVAFIGEKAHGKEFVQEILPLLEKKSVLYLRAKEIAS
SLDTILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEQGIQSYSAKKPSLEACLELALSLRVKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aatgaattttgctactatcccttagaattagatccaaccccttttaacgcccttattttc
acttctaaaaatgcggtgttttccttgctggaaactctaaaaaacagccccaaactcaaa
attttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaactttacaagat
caccattttaaagtcgcctttataggggaaaaagcccatggcaaagagtttgttcaagaa
atccttcctttattggaaaaaaaaagcgttttgtatctcagggcaaaagagattgcttct
tctttagacaccattcttttagagcatggcattgatttcaagcaagccgttgtttatgaa
aacaagctcaaacatttaaccttaagcgaacaaaacgccctaaaacccaaagaaaagagc
atccttatttttactgccataagccatgcaaaagccttcttgcactattttgaattttta
gaaaattacaccgctataagcattggcaacacgaccgctctttatttgcaagagcaaggc
attcaaagctatagcgctaaaaagccctccttagaagcatgtttagaactggctttaagt
ttgagggttaaagaatgttaa

DBGET integrated database retrieval system