KEGG   Helicobacter pylori Shi417: HPSH417_07010Help
Entry
HPSH417_07010     CDS       T02039                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hhr  Helicobacter pylori Shi417
Pathway
hhr00900  Terpenoid backbone biosynthesis
hhr01100  Metabolic pathways
hhr01110  Biosynthesis of secondary metabolites
hhr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSH417_07010
Enzymes [BR:hhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPSH417_07010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFH98518
Position
1446748..1447551
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKFKDIISVKSALSFSLKGDFDCPLE
ENSLFKTLQILKNFLKSKNFSHSAIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLEELYSMGSLVGADTNFFISQHKSANATSYGEVIENFEEKPLENRLEIYAPN
HVFCSTKAIYQAYKPEAYFSQAKEWLKKPSLECLKTCDRNELNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPALKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcctttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaagaa
ggggcttatcataagctcatttctcgcatgtgtttggtcaaagataaattcaaagatatt
atcagcgtcaaaagcgcgctttccttttcactaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaaaccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgccatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccggattaggcggtgggagcgctgatgctggggggctattgtatcatttgaat
caaatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtgggt
gcagacaccaactttttcatctcgcaacacaaaagcgctaacgctacttcttatggcgaa
gttattgaaaattttgaagaaaagcctttagaaaatcgcctagaaatctatgcgccaaac
catgttttttgcagcaccaaagctatttatcaagcctataaacctgaagcttatttttct
caagctaaagagtggcttaaaaagccgagtttagaatgcctaaagacttgcgacagaaac
gaattaaacgatcttttaaagccggctttactcactaaccaagccttaagaggtatagaa
agcgaattgggcaaggagtggttttttagcgggagtgggagcgcgttttttaggctaaag
cctgcgttaaaagggggcgaatga

DBGET integrated database retrieval system