KEGG   Helicobacter pylori Shi417: HPSH417_07110Help
Entry
HPSH417_07110     CDS       T02039                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hhr  Helicobacter pylori Shi417
Brite
Enzymes [BR:hhr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HPSH417_07110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1464342..1465394
Genome map
AA seq 350 aa AA seqDB search
MKKSILLGVCLAFSCAHALNDLELIKKARESQLEPMPMGKALKEYQIKKTKDVGIGTKNS
EIMTPAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAVGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFEALRGKKPKILYPELPVMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttattgggcgtttgcttggctttttcttgcgcccatgccttgaac
gatttagaactgatcaaaaaagcgagggaaagccaattagagcctatgcctatgggcaaa
gcgctcaaagaataccagattaaaaaaactaaagatgtgggtattggcaccaaaaacagc
gagattatgacccccgctcaagtggaattaggcaaaatgctctactttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataatctgggcttaggcggggtggat
ttagtcccaagcgctgtaggttctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactctgtgtttaacgatgtgcagttttgggatgggagagttacgcattta
aacgaacaagcacaagggcccatccagtcttcttttgaaatgggggctgatccaaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaaactctttagaaaagcttatggc
tccaaagtcaaaattgattttaaattgatcgcagatagtatcgctatgtttgaagccacg
cttatcaccccaagccgttatgatgattttttaagaggcaatcctaaagcgctcagtaaa
gccgaaaaagaagggctggatttattcatttctaaaggctgtgtggcttgccataacggc
attaatcttgggggaacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcaattttgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
actttctttgaagccttaaggggtaaaaaaccgaaaatactctatccggaactccctgta
atgacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system