KEGG   Halyomorpha halys symbiont: HHS_04540Help
Entry
HHS_04540         CDS       T02865                                 

Gene name
mrcB
Definition
MrcB protein
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
hhs  Halyomorpha halys symbiont
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hhs00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HHS_04540 (mrcB)
Enzymes [BR:hhs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     HHS_04540 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     HHS_04540 (mrcB)
Glycosyltransferases [BR:hhs01003]
 Polysaccharide
  Bacterial polysaccharide
   HHS_04540 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(611323..613563)
Genome map
AA seq 746 aa AA seqDB search
MIINWGIHLNSEIRNRLNSEIWQSPAIIYSRMVSLEPGMLYQKKDLITLLESTHYRNVSH
IMHSGEFSVKGDTIFILRRPFNFPDNKEGKIYVRITFNTNHDKLIEIKNVRTGRNFAFFR
LDPCLINMLQSSNGKQRFFVPKTGFPDLLINTLINTEDRRFYQHDGISPHSIGRAFLANI
IAGRAIQGGSTLTQQLVKNLFLTNERSIWRKIREVYMAIIMDASYSKDYILELYLNEVYL
GQVGNIQIRGFPLASLCYFNRSLNELSLDQQAMLVGMVKGASLYNPWRNLKISLQRRNLV
LYVLQQHKVIDKNLYTMLSTRPLKVQPKDRAIIAQPAFMQILRNELKIKLGRDKMKDLSS
MKIFTTLDPISQHAAEKAVREGIPILKKQYILKDLESAMVIVDRFSGELRAIVGGSNPQF
AGYNRATQARRSIGSLAKPATYLTALSQPDIYRLNSLISNQPITMKQPNGTLWKPMNNNH
LFSNKVMLVDALINSMNIPTINLGMTLGLDVIIDHWIKLGIPKDQLHPVPAILLGSLNLT
PIEVAQAFQSIASGGNRAKLSVIRSVIDKNGDVLYQSFPQSKRVEPEQAVYLTLYAMQEV
INHGTARALGARYPNAHLAGKTGTTNDLVDSWFAGIDGKEVAITWVGRDNNQTAKLYGAN
GAMQIYRRYLDNQPPMPLILKPPQGITYMHINSSGNFVCNQNTLRTLPVWILDPKQICQK
QKKNQKDTKKYDHNITDWIKEMFYNS
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgatcattaactggggtatccatcttaattctgaaattcgtaatcgtctaaatagcgaa
atatggcaatcaccagctattatttatagtcgtatggtcagtttagaaccaggaatgcta
tatcaaaagaaagatttgattactctactagaaagtacacattatcgtaacgtatcgcat
attatgcattctggcgaatttagtgtaaaaggtgacactatttttatactacgtcgtcca
tttaattttcctgacaataaagaaggaaaaatatacgtacgtatcacgttcaatactaat
catgacaaactaatagagattaaaaatgttagaacagggcgaaattttgctttctttcgt
cttgatccttgcttaattaacatgctgcaatcatcaaatggaaaacaacggttttttgtt
cctaaaacgggttttccagatttattaataaacacattaattaatacagaagatcgtcgt
ttttaccaacatgatggcatcagtcctcattctatcgggcgtgcttttcttgctaatatt
attgcaggacgtgcgatacaaggtggtagcacattaacacagcagctagtcaagaatctc
tttctgactaatgagcgttctatatggcgtaaaatacgtgaagtttatatggcaattata
atggatgcaagttacagcaaagattatatattagaactatatctaaatgaagtctatctt
ggtcaggtgggtaatattcagatacgaggttttccattagcaagtttgtgctattttaat
cgttcgttaaatgaattaagtcttgatcagcaggcaatgttagtaggaatggtaaagggt
gcatcgttgtataatccttggcgtaatttaaaaatttctttgcaacgtcgtaatttagtt
ttatatgttttacaacagcacaaagtgatagataaaaatctatacacaatgctctcaact
cgtccactaaaagttcaaccgaaagatagagcaattattgctcaacccgcatttatgcaa
atcttacgtaatgaattgaaaattaaacttggccgtgacaagatgaaagatctttcttct
atgaagatttttactacgcttgatcccatctcgcagcatgccgcagaaaaagctgtaaga
gaaggtattcctattcttaaaaagcaatatatcttaaaagatttagaatcagcaatggta
atagttgaccgatttagtggtgagttaagagcgatagtaggtggttctaatccacaattt
gccggttataaccgtgcaacacaggcccgtcgttctattggctcactagctaaaccagca
acctatctcacggcattaagtcaaccagatatttatcgccttaatagtttaatttcaaat
caaccaattactatgaagcaacctaatggtactctctggaaaccgatgaacaataatcat
ctttttagtaataaagtaatgttggtagatgcattaatcaattcaatgaatatacctaca
ataaatcttggcatgacattaggtttggatgtcattatagatcattggataaaacttggt
ataccaaaagatcaattacatcctgtgcccgcaattttgttaggttcgcttaacttaaca
cctattgaagtggcacaagcgtttcaatcaattgccagtggtggtaatcgtgcaaaatta
tcggtaattcgttcagtaattgataagaatggtgatgtattatatcaaagtttcccacag
tccaaaagggtagaacctgaacaggcagtatatttgacgttatatgccatgcaagaggtc
ataaatcatggcactgcacgtgcattaggagcgcgttatccaaatgcccatttagctgga
aaaactggtacaactaatgatttagttgatagttggtttgctggtattgatggtaaagaa
gtagctatcacttgggttggtcgcgataataaccaaactgcaaagctatatggtgccaat
ggagcaatgcagatttaccgtcgttatcttgataaccagcctccaatgccgttgatatta
aaacctccgcaaggtatcacttatatgcatattaattcttcaggtaattttgtatgtaat
caaaataccttacgcacattgcctgtatggatattagatccaaaacaaatatgtcaaaaa
caaaaaaaaaatcaaaaggatactaaaaagtacgatcataacataaccgattggattaaa
gaaatgttttacaattcataa

DBGET integrated database retrieval system