KEGG   Haliscomenobacter hydrossis: Halhy_0045Help
Entry
Halhy_0045        CDS       T01491                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hhy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
43125..45842
Genome map
AA seq 905 aa AA seqDB search
MYETMTITFQIHYQTNWGQQMAIVGNLPELGSGNEQQAQTMQYIGGGYWRVSIPLKKAPS
TLEYQYLLKDNASLSLLTAEWGNRRKLRISRLAGDHLFLKDSWRAVDHPENAFYTAAFSK
VIFKPQAQYKGNSITPDPLRLGIRFQLRAVQVPAGLQLAILGSLPELGAWDYGRPVLLSN
ADFPLWTGEISVGFRQGFEYKYGLYDPTVQRIIELETGPNRKLDGAPLDALVNSTIVNDE
YYANPAGNWKGAGVAVPVFSLRTAESMGVGEFNDLKKMIDWAQKAGLRMVQILPVNDTSA
NHTWTDSYPYAAITVFGLHPQFLHLDVLEGINTKKVATERKKLNLHPAVDYEAVNKAKLS
LAREAFNKTQKTFLSSPDFLSFFAESKHWLEPYAVFCYLRDKFKSVEFAENWGAYAQYTP
ALLEELASPTATDYADVAFHYYLQYHLDKQLREASDYARSKGLILKGDLPIGIYRHSVDA
WVAPHLYNMDGQAGAPPDPFSDNGQNWGFPTYNWAEMAKDGYLWWRQRMGQLSRYFDAYR
IDHILGFFRIWQIPLDQVEGTLGFFNPALPIMREELDARGIWFDQERYCKPFITKQLLDE
RFGEDVDDVRTQFLDEIRFNYFAFKPQYDTQRKIEQFFQAAENQDKIHLQPGLYKLISNV
LLLEIPGSNGRAFHPRIDLNKTYSFQNLDAVQQAKLQELYIDYFYRRQEDFWRAQAMQKL
PALKASTDMLICGEDLGMVPACVPGVMRELGILTLEIQRMSKNPATEFLQEEDIPYLSVA
SPSTHDMAPIRAWWEEEDRALISRFFHNELKFMGQEPYTCEPFLAKAVVEKHLRWPSMWT
VFPLQDLLAMDLKLRRENPAEERINVPAIMPYYWRYRMHLDLEDLIAAEGYNAMLHDLLH
RYDRA
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaaccatgacgattacttttcagatccactaccaaaccaattgggggcagcag
atggccattgttggcaatttaccagaattgggcagcggcaatgagcaacaggcccaaacc
atgcaatacattggtgggggctattggcgggtgtcgattccgcttaaaaaagcaccatct
acgctggaatatcaatatttgctcaaagacaacgccagcctttctttgctgaccgcagag
tggggcaatcgccgcaaactgcgcatctcgcgtttggcaggagatcaccttttcctcaaa
gacagttggcgtgcggtggatcatcccgaaaatgcattttataccgcggcgttttccaaa
gtgatcttcaaaccacaggctcaatataaaggcaattcgattacgccagaccccctgcgg
ctgggtattcgttttcaacttcgggccgtgcaagttccggcagggctacaattggccatt
ttgggcagtttacctgaattgggtgcctgggattacggtcgtccagtgctgctgagcaat
gccgattttccgctttggaccggagaaatcagcgtcgggtttcgtcagggttttgagtac
aaatacggactatacgaccccacagttcaacgcatcatcgaattggaaaccggccccaac
cgcaaactggatggtgcaccattggatgctctggtcaactccaccattgtcaacgatgaa
tactacgccaacccagcaggcaactggaagggtgcaggcgttgccgttccggtattttct
ttaagaaccgcagaaagtatgggggtaggggagttcaacgacctgaaaaaaatgatcgac
tgggcgcaaaaagcaggtttgcgcatggtgcagattttgcccgtaaacgatacttcggct
aaccatacctggacggattcttacccttatgcagcgataacggtatttggactgcatcca
caatttttgcacctggatgtattggaaggcatcaatacgaaaaaagtagcgactgagcgc
aagaaactgaaccttcatccggcagtagattatgaggcagtaaacaaagccaagttgagc
ctggcgcgtgaagcttttaacaaaacccaaaagacattcctgtccagcccggacttttta
agcttttttgcagaaagtaaacactggctggagccttacgccgttttttgttacctgcgc
gataaattcaaatcggttgagtttgcagaaaactggggagcctacgctcaatatactccg
gcgttattggaagaactcgcttcgcccacagccaccgattatgccgacgtcgcttttcat
tattacctgcaataccacctggacaaacaactgcgggaggcttcggattatgcccgttcc
aaaggtttgattctcaaaggtgacttgcctattggtatttaccgccacagtgtggatgcc
tgggttgcgccacatttgtacaatatggatggccaggctggcgcaccacctgatccattt
tcggacaacggccaaaactggggttttccaacgtacaattgggccgaaatggccaaagat
ggctacctctggtggcggcaacgcatggggcaactttcccgttattttgatgcctaccgc
atcgaccatattctgggctttttccgcatttggcaaattccgctggatcaggtggaagga
accctgggcttttttaaccccgcattgcccatcatgcgtgaagaactggatgccaggggg
atttggtttgatcaggaacgttactgcaaacctttcatcaccaagcaattgctggacgag
cgttttggagaagatgtggatgatgtgcgcactcagtttttggacgaaatccgcttcaac
tattttgctttcaaaccgcaatacgatacccagcgcaagattgaacagtttttccaggcc
gcagaaaaccaggacaagattcacctgcaacccggtttgtacaaactcatcagcaatgta
ctcctcctggaaatccctggcagcaatggccgggcattccatccgcggatcgatttgaac
aaaacttattctttccagaatttggacgctgttcaacaggccaaactacaggaattgtac
atcgactatttctaccgccgacaagaagatttttggcgggcacaagccatgcaaaaactt
ccagcgctcaaagcttccacggatatgctcatctgtggcgaagacctgggcatggtaccg
gcttgtgtacccggcgtcatgcgtgaattgggcattttgaccctggaaatccagcgcatg
tcaaaaaacccggccacagaatttttacaggaagaagacattccttacctctcggtagcg
agtccttctacccacgatatggcacctatccgagcctggtgggaggaagaagatcgggca
ctaatcagccgttttttccacaacgagctgaagtttatgggccaggagccttatacttgt
gagccatttttggcaaaagccgtggtagaaaaacacttgcgttggccgagtatgtggacg
gttttccccctacaggatttgctggcgatggacttgaaattgcggcgggaaaaccccgct
gaagagcggatcaacgtacccgccattatgccttattactggcgttaccggatgcactta
gatcttgaagatttgatagcagcagagggctataatgcgatgctacacgacctgctgcac
cgctacgatcgggcgtag

DBGET integrated database retrieval system