KEGG   Haliscomenobacter hydrossis: Halhy_0775Help
Entry
Halhy_0775        CDS       T01491                                 

Definition
butyrate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halhy_0775
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halhy_0775
   00620 Pyruvate metabolism
    Halhy_0775
   00640 Propanoate metabolism
    Halhy_0775
  Energy metabolism
   00680 Methane metabolism
    Halhy_0775
Enzymes [BR:hhy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Halhy_0775
Lipid biosynthesis proteins [BR:hhy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Halhy_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
976848..978545
Genome map
AA seq 565 aa AA seqDB search
MDIKDFFSKVREDVSKEQFDNLAGLTVHKPEYFNWVMDIFYDLNVKKHPGSTALIWRHYT
KEKRYTFERIYGAANQFLNFLRKHGIQKGNCIYTQLPLDPANWISTLAAIKGGLVLIPAA
INLIEKDIAYRFKTIFPEVVITDLANAEKIEVAEKILGKTVKVKILVDGERPGWHWIETI
QDEDQTAEAAKTLADDHLFYFFTSGTTGLPKIVTHTHFTYPFGHLSTASWIGMRHGDIHY
NISAPGWAKFAWSSFFAPWNMGATIFANQVDKFEAKEQLKTIEQYGVTTFCAPPTVLRMV
ILEDLSSYHFKFRQCVAAGEPLNAEIIEKWQQGTGIVIRDGYGQTETTCLVANLPGAKIK
YGSMGKPTFLYKVIIANDEGVEQPTFEEGNICIKMDDQKANGVFIDYLGEPERKALVFKH
GLYYTGDKAYQDEEGYIWFVGRDDDVIKASDFRIGPFEVESVLIEHESVVETAVVASPHP
LRGFAVKAFVLLRAGEMGSQELAEELFAHCENNLAAYKIPRIIEFVEALPKTISGKIRRV
ELRAGEAERKSRQEVSAAEFFHKKY
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaaggattttttcagcaaggtgagggaagacgtttcgaaggagcaattcgac
aatttggcgggtttgactgtacacaaacccgaatatttcaactgggtgatggatattttt
tacgacctgaatgtaaaaaaacatcccggcagcacggccttgatctggcgacactatacc
aaagagaagcggtacacctttgagcgcatctacggagcagccaaccagtttctgaatttc
ctgcgcaaacacggcatccaaaagggcaactgcatctatacccaactgcccctcgacccg
gccaactggatcagtaccctggcggccatcaaaggaggactggtgctcattccggcggcc
atcaatttgattgaaaaggacatcgcctatcgtttcaaaaccatttttcccgaagttgtc
atcacggatttggccaacgcggaaaaaatagaagtcgcggaaaaaatcctgggcaaaacc
gtcaaagtgaagatcctcgtggatggtgaacgacccggctggcactggatcgaaaccata
caggatgaagaccaaaccgctgaagcagccaaaaccctggcggatgatcatcttttttat
tttttcacctcgggtaccacgggtttgcccaaaattgtcacgcatacccacttcacatat
ccctttggccatttgtctaccgcttcctggatcgggatgcggcatggcgatatccactac
aacatctccgcgcccggctgggcaaaatttgcctggagcagcttttttgccccctggaac
atgggggcgaccatttttgccaatcaggtggataaatttgaagcaaaagagcaattaaaa
accatcgagcaatacggcgtcaccactttctgcgccccgccaacggtgctccgcatggtg
attctggaagatttatccagctaccatttcaagttcaggcaatgtgtagccgccggtgaa
cctcttaatgccgaaatcattgaaaaatggcaacaaggcacgggcatcgtgatccgggac
ggatatggccaaaccgaaacaacttgcctggtggccaatcttcccggcgcaaaaatcaaa
tacggctccatggggaaacccacttttttgtacaaggtcatcattgccaatgacgaaggc
gttgagcagccgacttttgaagaaggcaacatttgtatcaaaatggatgaccaaaaagcc
aatggtgtcttcatcgattacctgggggaacctgaacgcaaagcactggtttttaagcac
ggtttgtactacactggcgacaaagcttaccaggatgaagaaggctacatctggtttgtg
ggccgggatgatgacgtgatcaaagcctccgatttcaggattggcccttttgaagtggaa
agtgtattgattgaacacgagtcggtagtagaaactgcggtggtggcgagcccacatcca
ctgaggggttttgcagtgaaggcctttgtgctgttaagggcgggagaaatgggcagtcag
gaactggccgaggaattgtttgcccattgtgaaaacaacctggctgcttacaaaatcccc
cggatcatcgagtttgtggaagcactccccaaaaccatcagtgggaaaatccgccgggtt
gaattgagggccggtgaagccgagcgcaaaagcagacaagaggtaagcgcagctgaattt
tttcacaagaaatactag

DBGET integrated database retrieval system