KEGG   Haliscomenobacter hydrossis: Halhy_0838Help
Entry
Halhy_0838        CDS       T01491                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Halhy_0838
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Halhy_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1039520..1040200)
Genome map
AA seq 226 aa AA seqDB search
MVTTDNTLDLVLGQKAQTMGDNHISTGVETPLRPDAFDMNDKEKMEIIAHHFAAIMDTLG
LDLNDDSLQDTPKRVAKMFVQEIFHGLNPANKPEISAFDNSYDYKRMLVEKNITVKTFCE
HHFLPITGKAHVGYVSNGKVIGLSKLNRIVDYYARRPQVQERMTKQILLALQEALDTKDV
IIVVDAKHMCVSHRGIQHDESTTLTLEYSGCFENNDMRREFMDCLK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggtgactacggataataccctcgacttggtattgggtcaaaaagctcaaactatgggc
gacaaccatatcagtacgggggtagaaaccccattgcggcctgatgcgttcgatatgaac
gacaaagagaagatggaaatcatcgcccatcattttgctgccatcatggataccctgggc
ctggatctaaacgacgacagtctgcaggatacgcccaaacgggtagctaaaatgtttgtt
caagaaatttttcatgggcttaaccctgccaataaaccggaaatatcggcttttgacaac
agctacgattacaaacggatgttggtggaaaaaaacattacggtaaaaaccttctgtgag
caccactttttgcccattaccggcaaggcccatgttggctacgtgtcgaatggtaaagta
atcggcttgtccaagttgaaccgcattgttgattattatgcacggcgcccccaagtgcaa
gagcgcatgaccaaacaaattttgctggcattgcaagaagcgctggacactaaagatgtg
atcattgtggtggatgccaagcacatgtgtgtcagtcatcgggggattcagcacgatgaa
agcaccaccctcaccctggagtacagtggttgttttgaaaacaacgacatgcgccgggag
tttatggattgcctgaaataa

DBGET integrated database retrieval system