KEGG   Haliscomenobacter hydrossis: Halhy_0998Help
Entry
Halhy_0998        CDS       T01491                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Halhy_0998
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Halhy_0998
Enzymes [BR:hhy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Halhy_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227771..1228706
Genome map
AA seq 311 aa AA seqDB search
MASANQQLSSKHLLGIKDLSTEDIRLIFHTATNFKEVINRPIKKVPSLRDITIANLFFED
STRTRVSFELAEKRLSADTINFSASSSSVKKGETLLDTVNNILSMKVDMVVMRHPAPGAC
QFLAQHIDANIINAGDGTHEHPTQALLDAFSMQEQLGDLEGKNVAIFGDILHSRVALSNI
FCLQKLGAKVRVCGPPTLMPKFIHKLGVGVSYNVRETLQWCDVANILRIQLERQNIKYFP
TLREYAQYFGINRQLLDSLDKKIVIMHPGPINRGVEITSDVADSEHSIILQQVENGVAVR
MAVLFLLAAKG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgctaaccaacaactgagcagcaaacaccttctgggcatcaaagacctgagc
acggaggacattcggctcatttttcataccgcaacaaactttaaagaagtcatcaatcgt
cccatcaaaaaagtgccttccctgcgcgacatcaccatcgccaatctcttttttgaagac
tctacccgcacccgggtgtcgtttgaattggcggaaaaacgcctttcggcagatacgatc
aacttttcggcttcttcttcttcggtcaaaaaaggggaaaccctgctggatacggtgaac
aacatcctgtccatgaaagtggacatggtggtgatgcgtcaccccgctcccggtgcctgc
cagtttttggcgcagcacatcgatgccaatatcatcaacgcgggcgacggcactcacgaa
caccccacccaggcgttactcgacgccttttccatgcaagagcaactgggcgacctggaa
ggcaaaaacgtcgccatttttggcgacatcctgcactcccgcgtggctttgagcaacatc
ttttgtctgcaaaaactgggggccaaagtaagggtttgtggcccccctaccctgatgccc
aagttcatccacaaactgggcgtcggcgtcagctacaacgtgcgcgaaaccctgcaatgg
tgtgacgtggccaacatcctgcgcatccagctggagcgccaaaacatcaagtatttcccc
accctgcgggaatatgctcaatacttcggcatcaaccggcaattgctggattcgctggac
aaaaaaatcgtgatcatgcaccccggcccgatcaatcgcggcgtggaaatcaccagcgat
gtggcggattcggaacattccatcattttgcaacaggtggaaaatggggtggcggtaaga
atggcggtgttgtttttgttggcggctaaggggtag

DBGET integrated database retrieval system