KEGG   Haliscomenobacter hydrossis: Halhy_1028Help
Entry
Halhy_1028        CDS       T01491                                 

Definition
Mg-chelatase subunit ChlI-like protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Halhy_1028
Enzymes [BR:hhy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Halhy_1028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1256056..1257537)
Genome map
AA seq 493 aa AA seqDB search
MNSITTLGALKASGYQPKSVKAELRANLIEKLKKRETIFEGVLGFEDTVLPDIERAVLSR
HNILLLGLRGQAKTRIARLLVKLLDEYIPVVGGSELNDDPLNPISRYAKDLIAEMGDATP
VEWLHRDERYVEKLATPDVSVADLIGDVDPIKAATLKMAYSDERVIHFGLVPRAHRSIFV
INELPDLQARIQVSLFNILQEGDIQIRGFKLRLPLDIQFLFTANPEDYTNRGSIITPLKD
RIESQILTHYPKTIDIARSITKQEAKLTAEQRAKVEVPDLLEVLLEQVAFEARDSEFVDS
KSGVSARLTISGYENLVSTAERRLLINRENKTIARLTDFWGVVPAITGKVELVYEGEQEG
PYLVAINLMGKAFKKLFLDHFPDPDKLRKGRDRDPYGVIRAWFSGGHAVNLLNDMSDKEF
RAALEGVAGLRKFVEATLPQLSGDEVYTYMELVLHGLAEFQVVSKDMVESKLTFRDTLAD
MLSSEDLFDEEDN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaattccattactactttaggggctttaaaagccagcggttatcaacccaaatcggta
aaagcagaactccgggccaatctgatcgaaaaactcaaaaaacgggaaacgatttttgag
ggcgtactcgggtttgaagataccgttttgccagacattgagcgcgctgtattgtcgcgg
cacaatatcttgttgttgggtttgcgtgggcaggccaaaacccgtattgcgcggctcttg
gtcaagctgctggacgagtacattccggtggtaggaggtagtgaactgaacgacgaccca
ctcaaccccatttctcgttacgccaaagacttgattgccgaaatgggcgatgctaccccc
gttgaatggttgcaccgcgacgagcgctacgtggaaaaactggctacccccgatgtgagt
gtcgccgacctcattggcgatgtagaccccatcaaagcggctacccttaaaatggcttac
tccgacgagcgggtgatccactttggcctggtaccccgggcgcaccgcagcatttttgtc
atcaatgaattgcccgatttgcaggcgcggatccaggtatccctgttcaatattttgcag
gagggtgacatccagattcgtggattcaaactgcgtttgccactggacatccagtttctc
tttacagccaaccccgaggattacaccaaccggggcagcatcatcaccccgctgaaagac
cgcatcgagagccaaatcctgacgcactaccccaaaaccatcgacattgcccgcagcatc
accaagcaggaagccaaacttaccgctgaacaacgcgcaaaagtagaggtccccgatttg
ttggaggttttgctggagcaagtagcttttgaagcacgggatagtgagtttgtcgattcc
aaaagtggggtgtcggcgcgtctgacgatttcgggttatgaaaacctggtcagcactgcc
gagcggcgtttgttgatcaaccgcgaaaacaaaaccatcgcccgcctgaccgatttctgg
ggcgtagtacccgccattacgggtaaagtggaattggtgtacgaaggagaacaagaaggc
ccgtacctggtggcgatcaacctgatgggcaaagctttcaaaaaattgttcctcgatcat
ttccccgacccggataagctccgcaaagggcgcgaccgcgatccatacggcgtgatccgg
gcctggttcagcggtggacacgccgtgaacctgctcaatgacatgagcgacaaagaattc
cgcgcggcactggaaggtgtagcgggcttgcgcaaattcgtggaggccacgcttccgcag
ctcagcggggatgaggtgtacacctatatggagctggtgctacacggtttggccgagttc
caggtggtcagcaaagatatggtcgaatccaaattgaccttccgcgataccttggcagat
atgctgagttcagaggatctttttgatgaggaagacaattga

DBGET integrated database retrieval system