KEGG   Haliscomenobacter hydrossis: Halhy_1114Help
Entry
Halhy_1114        CDS       T01491                                 

Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Halhy_1114
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Halhy_1114
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Halhy_1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1367790..1369244
Genome map
AA seq 484 aa AA seqDB search
MKLNVLTFFLLLFTACTPKTSSIDSEKTGNIDRKTVAIFTTADSTKLRLSPGEALIFSPF
GQPFENQPCVFVDPAHQFQTFVGIGAALTDAAAETFAKLPPAKQTELLQAYFDPQKGIGY
TLARTNINSCDFSSDMYTYVDDNDRELKSFTLAHDERYKVPFIKKATAAAGGNLPLLVSP
WSPPAWMKDNQNMLQGGKLKPEFFDSWANYYVKFIQGYEKMGIPIWGLSVQNEPMAKQTW
ESCIFTAQEETDFIKNHLGPTLKKNGLADKKLIAWDHNRDLIYQRASTYLSDPGAAKYIW
GIGFHWYEIWNGGRQYENVKRVAEAFPDKNLLLTEACNYPFSWQTFDQWSWGEQYGENMI
HDFNNGAVAWIDWNILLDETGGPNHVKNFCFAPVHAKTQAGSLHYMNSYYYIGHFSKFIR
PGAKRIISSSSRAQLLTTAFLNPDGSIVLIVMNQRKEKISYHLCLGGQAVETVSLPHSIV
TMVF
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaacgtcctaaccttttttctactgctcttcaccgcttgcacaccgaaaaca
agcagcatagattcggaaaaaaccggcaacatcgatcgaaaaactgttgccattttcact
actgcggacagcaccaaactccggctgagtccgggagaggcattgattttttctccattt
ggccagccgttcgaaaatcaaccctgcgtattcgtcgatccagctcatcagtttcaaact
tttgtcggcatcggcgcagcacttacggatgcagcagcagagacctttgccaaactccct
ccagccaaacaaaccgaacttttacaggcctacttcgacccccaaaaaggcattggttat
actttagcccgcaccaacatcaacagttgtgatttttcgagcgatatgtatacctatgtt
gatgataatgatcgggaattgaaatcgtttacccttgcacacgacgaacgatacaaagtt
ccgtttatcaaaaaagcaaccgccgcagctggaggaaacttacccctattggtcagcccc
tggagccctccagcatggatgaaggacaaccagaacatgctgcaaggtggaaaattgaaa
cccgagttttttgattcctgggcaaattattatgtgaaattcatccaaggatatgaaaaa
atgggaattccgatttgggggctttcggtacaaaacgaaccgatggccaagcaaacctgg
gaatcttgtatttttacggcgcaggaagaaaccgattttattaaaaatcatcttggccct
accctgaaaaagaacgggcttgccgacaaaaaactcatcgcatgggaccacaaccgcgac
ctaatttaccaacgtgcatccacttaccttagtgaccctggtgccgcaaaatacatctgg
ggcattggttttcactggtacgaaatttggaatggtggtcggcagtatgaaaatgtgaaa
cgggttgcagaagccttccctgataaaaatctgctccttaccgaggcttgcaattatcct
ttttcgtggcaaacctttgaccaatggtcttggggcgaacaatacggggaaaacatgatc
catgatttcaacaatggagctgttgcctggattgactggaatattttgctcgacgaaaca
ggtggccccaaccacgtaaaaaatttctgtttcgctccagtccatgccaaaacccaagcg
ggtagcctgcactacatgaattcttactactacattggccatttttcaaaatttatccgc
cctggagcaaagcgcatcatcagttcatcaagccgggcacaattgctcactacggcattc
ctcaatcctgatggcagcattgtcttgatcgtaatgaatcagcgtaaagaaaaaataagc
taccatctgtgcctgggaggacaagctgtggaaacagttagtttaccacattccatcgtt
acaatggtgttttaa

DBGET integrated database retrieval system