KEGG   Haliscomenobacter hydrossis: Halhy_1277Help
Entry
Halhy_1277        CDS       T01491                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halhy_1277
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halhy_1277
   00052 Galactose metabolism
    Halhy_1277
   00500 Starch and sucrose metabolism
    Halhy_1277
   00520 Amino sugar and nucleotide sugar metabolism
    Halhy_1277
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halhy_1277
   00524 Butirosin and neomycin biosynthesis
    Halhy_1277
Enzymes [BR:hhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Halhy_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1596355..1597257
Genome map
AA seq 300 aa AA seqDB search
MLAIGMDLGGTAVKAVVIDHYGNVLKTMSKPLGQHATSIDEWNWKGVVKSVAADLMEEFK
GRITAMGMSAPGICNEENTAIYSMPGRFYGLEKFIWTEYLDHETWILNDAHSALMAEAQF
GAAKGYKHAILLTLGTGVGGGIIIDGKLLQGRNMMAGHLGHITVDADNPELDIFKIPGSI
EDHIGNATIEKRTYNRYEATHELEAAYRAGDPVATYVWLSSVRKLSIAMCSLINALSPEV
FVLGGGIAQAGDSLMKPLAAFMEIHEWRPRGEGVPVVVAHHGEHAGAIGAAAFAIRQSTK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgttggcaattggaatggatctgggcggtactgcggtaaaggcagtcgtcattgaccac
tacggaaatgtgcttaaaacgatgtccaaaccccttggacaacacgcgacctccatcgat
gaatggaattggaaaggcgttgtaaaatcagttgcagcagacctgatggaagaattcaaa
gggcgcatcaccgccatggggatgtctgctccgggcatttgtaacgaagaaaatacggcc
atttattccatgcccggacgcttttacgggctggaaaaattcatctggacggaatacctc
gaccacgagacctggatcctcaatgacgcccacagcgccctgatggccgaagcccagttt
ggcgctgccaaaggctataaacacgccatcctgctcaccctgggtacgggcgttggcggc
ggcatcatcatcgatgggaaactgctgcaaggccgcaacatgatggccggacaccttgga
cacattactgtagatgcggacaatcccgaactggacatcttcaaaatcccgggcagcatc
gaagaccacatcggcaatgcgaccatcgaaaaacgcacctacaatcgttacgaggcgacc
catgaactggaagcggcttaccgcgctggtgacccggtggctacctacgtctggctgagt
tcggtacgcaagttgtccatcgccatgtgctccctgatcaatgcgctttcgcccgaggtt
tttgtcctcggcggcggtatcgcccaggcgggtgattcattgatgaagcccttggctgcg
tttatggaaattcacgaatggcgtccgcgtggcgaaggggttccagtggtagtcgcccat
catggggaacacgccggggcgattggggcggcggcgtttgcgattcggcagagtacgaag
tag

DBGET integrated database retrieval system