KEGG   Haliscomenobacter hydrossis: Halhy_1277Help
Entry
Halhy_1277        CDS       T01491                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00010  Glycolysis / Gluconeogenesis
hhy00052  Galactose metabolism
hhy00500  Starch and sucrose metabolism
hhy00520  Amino sugar and nucleotide sugar metabolism
hhy00521  Streptomycin biosynthesis
hhy01100  Metabolic pathways
hhy01110  Biosynthesis of secondary metabolites
hhy01120  Microbial metabolism in diverse environments
hhy01130  Biosynthesis of antibiotics
hhy01200  Carbon metabolism
Module
hhy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halhy_1277
   00052 Galactose metabolism
    Halhy_1277
   00500 Starch and sucrose metabolism
    Halhy_1277
   00520 Amino sugar and nucleotide sugar metabolism
    Halhy_1277
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halhy_1277
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Halhy_1277
Enzymes [BR:hhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Halhy_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEE49172
UniProt: F4KV06
Position
1596355..1597257
Genome map
AA seq 300 aa AA seqDB search
MLAIGMDLGGTAVKAVVIDHYGNVLKTMSKPLGQHATSIDEWNWKGVVKSVAADLMEEFK
GRITAMGMSAPGICNEENTAIYSMPGRFYGLEKFIWTEYLDHETWILNDAHSALMAEAQF
GAAKGYKHAILLTLGTGVGGGIIIDGKLLQGRNMMAGHLGHITVDADNPELDIFKIPGSI
EDHIGNATIEKRTYNRYEATHELEAAYRAGDPVATYVWLSSVRKLSIAMCSLINALSPEV
FVLGGGIAQAGDSLMKPLAAFMEIHEWRPRGEGVPVVVAHHGEHAGAIGAAAFAIRQSTK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgttggcaattggaatggatctgggcggtactgcggtaaaggcagtcgtcattgaccac
tacggaaatgtgcttaaaacgatgtccaaaccccttggacaacacgcgacctccatcgat
gaatggaattggaaaggcgttgtaaaatcagttgcagcagacctgatggaagaattcaaa
gggcgcatcaccgccatggggatgtctgctccgggcatttgtaacgaagaaaatacggcc
atttattccatgcccggacgcttttacgggctggaaaaattcatctggacggaatacctc
gaccacgagacctggatcctcaatgacgcccacagcgccctgatggccgaagcccagttt
ggcgctgccaaaggctataaacacgccatcctgctcaccctgggtacgggcgttggcggc
ggcatcatcatcgatgggaaactgctgcaaggccgcaacatgatggccggacaccttgga
cacattactgtagatgcggacaatcccgaactggacatcttcaaaatcccgggcagcatc
gaagaccacatcggcaatgcgaccatcgaaaaacgcacctacaatcgttacgaggcgacc
catgaactggaagcggcttaccgcgctggtgacccggtggctacctacgtctggctgagt
tcggtacgcaagttgtccatcgccatgtgctccctgatcaatgcgctttcgcccgaggtt
tttgtcctcggcggcggtatcgcccaggcgggtgattcattgatgaagcccttggctgcg
tttatggaaattcacgaatggcgtccgcgtggcgaaggggttccagtggtagtcgcccat
catggggaacacgccggggcgattggggcggcggcgtttgcgattcggcagagtacgaag
tag

DBGET integrated database retrieval system