KEGG   Haliscomenobacter hydrossis: Halhy_1360Help
Entry
Halhy_1360        CDS       T01491                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00071  Fatty acid degradation
hhy00280  Valine, leucine and isoleucine degradation
hhy00281  Geraniol degradation
hhy00310  Lysine degradation
hhy00362  Benzoate degradation
hhy00380  Tryptophan metabolism
hhy00410  beta-Alanine metabolism
hhy00640  Propanoate metabolism
hhy00650  Butanoate metabolism
hhy00903  Limonene and pinene degradation
hhy00930  Caprolactam degradation
hhy01040  Biosynthesis of unsaturated fatty acids
hhy01100  Metabolic pathways
hhy01110  Biosynthesis of secondary metabolites
hhy01120  Microbial metabolism in diverse environments
hhy01130  Biosynthesis of antibiotics
hhy01200  Carbon metabolism
hhy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Halhy_1360
   00650 Butanoate metabolism
    Halhy_1360
  Lipid metabolism
   00071 Fatty acid degradation
    Halhy_1360
   01040 Biosynthesis of unsaturated fatty acids
    Halhy_1360
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Halhy_1360
   00310 Lysine degradation
    Halhy_1360
   00380 Tryptophan metabolism
    Halhy_1360
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Halhy_1360
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Halhy_1360
   00281 Geraniol degradation
    Halhy_1360
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Halhy_1360
   00930 Caprolactam degradation
    Halhy_1360
Enzymes [BR:hhy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Halhy_1360
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Halhy_1360
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Halhy_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH
Motif
Other DBs
NCBI-ProteinID: AEE49255
UniProt: F4KW67
Position
complement(1697443..1699593)
Genome map
AA seq 716 aa AA seqDB search
MIYYKKDTDNIVTLTLDMKGRPMNVINHEIFEAFVPVVEQLKADKKRGTLRGVILTSGKK
TFLAGGDLEYLYQTHDPAEVFAFCEKMKKFLRELESPGVAVVAALNGSAIGTGFEVALAC
HHRIAVNDKRTVLGLPEVELGLIPGGGGIVRLMWLLGIEKAFHILSSGQRYSPREALQAG
IIDDLAPNQKEMLEMAKDWLLSNKESRRPWDQTGQSIPGGSAKEATAAEYVRAEAARLAA
KTHHNYPAPQAILNVLSEGSKVDFDTAERIESRYYTQLVMSKQCKNMIKAFWFDSNYIKH
GLNRPKGFGKFRPKKVGIIGAGGLMGSGIAYACLQNGLDVVMKDVSKLIAERGRDYVRNK
LHPLIQSGEMTKAEGDKMMHRIVTTEDPREFETCDLVIEAVFENAMVKQKVTKEAEVFMD
EYSFMASNTVSIPITKLAEVSMRPDNYVGLHFFHPADEVPLVEIVRGARTSEETVARAFD
FVKAIQKTPIIVKDDWGFYAARVQNTYILEGITMLKEGYPPALIENLGRQAGMPKGALAM
ADDLGLNLVFNYESQAGEHYGPKYIPHPAVEALDKMLQELQRPGRHKKAGFYTYAEDGQR
QLWPELSTHFGPQLSNFDRQELIDRLLISQVLEAVWCMQEGVINSIAAANLGSIYGWGFP
SFKGGTIQYIADYGVEAFIARCKDLRGKYGSRFRIPKRLEELVKDSELVGDLVGMV
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatttattacaaaaaagataccgacaacatcgtcacccttaccctggacatgaaaggg
cggcccatgaacgtgatcaaccacgagatcttcgaggcatttgttccggtggtggaacaa
ttgaaagccgacaaaaagcggggcacactccgcggggtgattttgacttcgggcaaaaaa
acctttttggcgggaggagatctggaatatttgtaccaaacccacgacccggcagaggtt
tttgctttttgtgaaaaaatgaaaaaattcctgcgcgaactggaaagtcccggcgtagca
gtggtggccgcgctcaatggcagtgccatcggtacgggttttgaagtggcgctggcttgt
caccaccgcattgccgtcaatgacaaacgtacggtattgggtttgcccgaagtggaactg
ggcttgatccccggtggcggagggattgtgcgcctgatgtggttgttggggatcgaaaaa
gccttccacattctaagcagtggtcaacgttactccccccgggaggcgctgcaagcgggc
atcatcgacgatttggctcccaatcaaaaagagatgttggagatggccaaagattggcta
ctcagcaacaaagaaagtcgccgtccctgggatcagaccgggcaaagcatccccggtggc
tcggccaaagaagccactgcggctgaatacgttcgggcggaagcggctcggttagcggct
aaaacccaccacaattacccggcaccacaagccattctcaacgtattgtcagaaggctcc
aaggtagattttgataccgccgaacgcatcgaaagccgttactacacccaactggtcatg
agcaagcagtgcaaaaacatgatcaaagccttttggttcgacagcaattacatcaaacac
ggcctcaatcggcccaagggatttggcaagtttcggcctaaaaaagtgggcatcatcggg
gcgggtggactcatgggatcgggcatcgcctacgcttgtttgcaaaacggcctggacgtg
gtgatgaaagacgtatccaaactcatcgctgagcgtgggcgggattatgtgcgcaacaaa
ctccatccactcatccaatccggcgagatgaccaaagccgagggggataaaatgatgcac
cgcattgtcactaccgaagatccccgcgagtttgaaacctgtgacctcgtgattgaagcg
gtatttgaaaacgcgatggtcaaacaaaaagtgaccaaagaggcggaggtttttatggac
gagtactcgtttatggccagcaatacggtgtcgattccgatcaccaaattggccgaagta
tccatgcgtcccgacaattacgtgggtctccacttttttcaccccgccgatgaagtgccg
ctggtggagattgtacgcggtgcccgcacttcggaggaaaccgttgcgcgtgccttcgac
tttgtaaaagcgattcaaaaaacgcccatcattgtcaaagacgattggggtttttatgcg
gcacgggtgcaaaacacctacatcctggagggcatcacgatgctcaaagagggctatcct
ccggccttgattgaaaacctgggtcggcaggcgggtatgcccaaaggtgccctggccatg
gctgatgacctgggcctcaacctggtgttcaattacgaaagccaggcgggggaacactac
ggccccaagtacatcccgcacccggcggtagaagcactcgataaaatgctgcaagaactc
cagcgccccggacggcacaaaaaagcaggtttttatacctacgccgaagatggtcaacgc
cagctttggcccgagttgagcacccattttggcccacaactcagcaatttcgaccgccag
gaattgattgatcggttgctcatttcccaggttctggaggcggtgtggtgcatgcaggag
ggggtgatcaattcgattgcggcggccaatttgggcagtatttatggatggggttttcct
tcatttaaagggggcaccattcaatacatcgccgattatggggtagaggcttttattgcc
cgctgcaaagatttgcgcggcaaatatggctcgcgcttccgcattccgaaacgtttggag
gaattggtgaaggacagcgaattggtgggggatttggtcgggatggtatga

DBGET integrated database retrieval system