KEGG   Haliscomenobacter hydrossis: Halhy_1985Help
Entry
Halhy_1985        CDS       T01491                                 

Definition
Fmu (Sun) domain-containing protein
Orthology
K03500  
16S rRNA (cytosine967-C5)-methyltransferase [EC:2.1.1.176]
Organism
hhy  Haliscomenobacter hydrossis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2500378..2501583)
Genome map
AA seq 401 aa AA seqDB search
MKTNRINVTSEQVSAICTAAAQVLQDNRFADHAIERQLKAHPHWSIEEQGFVAEQVYALV
RYYRMLCAVAGKTPASMLDWEDLLGAWLMLKNHPLGAQFKFLTRNEINNAYHTIYKVRAV
RESIPDWLDELGFQELGEQWEPTLKALNESPSLVLRVNRLKTDVATLQQQLQQTDIIGKA
IAEDTLVIEQRGKLYHTAAFRHGWFEVQDYSSQQVAPFLEVEPGMRVIDACAGNGGKALH
LASLMQNKGRIIALDTDDKKLEQLRVRARRAGVSIIETRLIESTKTIKRLAQSADRLLLD
VPCSGLGVLRRNPDTRWRLSPEHLQELIALQKQLLSSYAKMCRPDGKMVYATCSILPSEN
QLQIDAYINGVGSNYKVEASKHIFPQEAGFDGFYMARLIQH
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaaacaggataaacgttaccagcgaacaagtttctgcgatttgtactgcagct
gcgcaggttttacaagacaatcgttttgccgatcacgccattgaacggcaattaaaagcc
cacccacattggtctatcgaagaacagggatttgttgccgagcaagtgtatgccctggtg
cgctactaccgcatgctgtgtgctgtagctggaaaaacacccgccagcatgctggactgg
gaagatttattgggtgcctggttgatgctgaaaaaccatccattgggtgcgcagtttaaa
tttctcaccagaaacgaaatcaacaacgcctaccatactatatataaggtgagggccgtc
cgggaatctatacccgattggctcgatgagttagggttccaggagttgggagaacaatgg
gaacctacgcttaaagcactgaatgaatctccatcgctggttttacgtgttaaccggctg
aaaaccgatgtagctacccttcaacaacagctacagcaaaccgacatcatcggcaaagcc
attgcagaggatacattggttatcgaacagcggggtaagctctaccatactgcggcattt
cgccatggttggtttgaagtacaggattattcttctcagcaagtagccccctttttggaa
gtggaaccgggcatgcgggtcattgatgcctgtgcgggcaatgggggcaaagcccttcac
ctggccagcctgatgcaaaacaaaggccgcattatcgcactggacacggacgataaaaaa
ttggaacaacttcgggtacgagcacgacgcgccggagtgagcattatcgaaactcgtttg
atcgaatctaccaagaccattaaacggctagcccaatcggcagaccgactccttttggat
gttccttgttcgggacttggtgttttgcggcgcaatccagatacccgctggcgtttgtcg
cccgaacacctccaggaattgatcgccctgcaaaagcagctattgagttcctatgctaaa
atgtgtcggcctgatggtaaaatggtgtacgccacctgtagcatcctgccttcggaaaac
caactacaaattgatgcctatattaatggtgtaggatcaaattacaaggtagaggcgagc
aaacacatctttccgcaagaggcggggtttgatggtttttacatggctcgcctgatccaa
cattaa

DBGET integrated database retrieval system