KEGG   Haliscomenobacter hydrossis: Halhy_2148Help
Entry
Halhy_2148        CDS       T01491                                 

Definition
(GenBank) Polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00010  Glycolysis / Gluconeogenesis
hhy00520  Amino sugar and nucleotide sugar metabolism
hhy01100  Metabolic pathways
hhy01110  Biosynthesis of secondary metabolites
hhy01120  Microbial metabolism in diverse environments
hhy01130  Biosynthesis of antibiotics
hhy01200  Carbon metabolism
Module
hhy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halhy_2148
   00520 Amino sugar and nucleotide sugar metabolism
    Halhy_2148
Enzymes [BR:hhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Halhy_2148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEE50033
UniProt: F4KRS9
Position
complement(2781977..2782804)
Genome map
AA seq 275 aa AA seqDB search
MGSRVRGFGGSRVRTPEPPNPRTPEHKIMAKHILGVDVGGSGIKGALVDIKTGKLIGNRV
RVDTPAGTPDIIAEAFAGLVKKIGYEGPIGCGFPAIVQHGVAKSAANIDKGWIGHNIEQE
FSDACGNPVKALNDADAAGLAELTFGEGKKVKGVVILITIGTGLGTAQFVDGTLVPNTEF
GHLYLHGRIAEHYCSNRVREEENLSWADWAHRFSEYLRHLERLLTPDLFILGGGVSKEFS
DFGHLLKVGVPVRPAKLLNNAGIVGAAVYAAKQHK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgagggttcgggggttcgggggttcgagagttcgaacccccgaacccccgaac
cctcgaacccccgaacacaaaataatggctaagcacatactcggcgtagatgtcggtgga
tcaggaatcaaaggcgctttggtggacatcaaaacgggcaagctcattggcaatcgggtc
agggtagataccccggctggtacccccgatatcattgccgaagcttttgcgggtttggtg
aaaaaaatcggctacgaaggacccattgggtgtggttttccagccattgtccaacatggg
gtagccaaatcggcggccaacatcgacaaaggctggattgggcacaacatcgagcaagaa
ttcagcgatgcttgtggcaatcccgtcaaagcgctcaacgacgccgacgcggctggacta
gccgaattgacttttggagaaggcaaaaaggtaaagggagtagtgatcctcattacgatt
ggtacaggactgggcacggcgcagtttgtagatggaaccctggtgcccaataccgagttt
ggtcacctttacctgcatggccgcattgccgagcactattgctccaaccgcgtccgggaa
gaagaaaacctgagctgggccgactgggcgcatcgctttagtgaatacctgcgccatttg
gagcgcctgcttacgcccgatttgttcattctgggcggaggcgtgagtaaagaattttca
gattttgggcacttgctcaaagttggagtgcccgtgcgcccagcgaagttattgaacaat
gcagggattgtaggcgcggcggtgtatgcggcaaagcagcacaaataa

DBGET integrated database retrieval system