KEGG   Haliscomenobacter hydrossis: Halhy_2286Help
Entry
Halhy_2286        CDS       T01491                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Halhy_2286
Enzymes [BR:hhy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Halhy_2286
Exosome [BR:hhy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Halhy_2286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2962182..2964080
Genome map
AA seq 632 aa AA seqDB search
MSKVIQHSLFTDYDIYLFKSGTHFRIYEKMGSHLIEVEGQKGVYFSVWAPNAQSVSVIGN
FNFWNTQEHPLSSRWDGSGIWEGFIPGLEKGTLYKYHIHAQSGQHLEKGDPYALFWEVPP
KTASIVWDNDYTWNDQDWLKKRQEKAGKPQPYSVYEVHMGTWKKNGNESLSYRELAEDLV
DYLKEMNFTHVEFLPVMEHPYFPSWGYQVTGYFAPTSRFGTPQDFMYLVDKLHQAGIGIL
LDWVPSHFPTDAHGLAEFDGTYLYEHSDPRKGFHPDWKSAIYNFGRNEVRNFLTSNALYW
LDRFHIDGLRVDAVASMLYLDYSREEGEWIPNEQGGKENLDAISFLREFNTMTYREFPDV
ITIAEESTAWSGVSHPTYAGGLGFGQKWMMGWMHDTLDYFNKDTIHRKYHHGEITFSLIY
AFTENFMLPLSHDEVVHGKGPLIDRMPGDEWQRFANLRLMYGYMYTHPGTKLLFMGGEFG
QTTEWSIERGLEWWLLEFGPHKGVQAWVRDLNAFYSAQPALYEKQFSNEGFEWVEHGDWE
NSVLAYLRKGEKAEENLLVVCNFTPVTREGFRVGVPAKGKWKEVLNSDAKIYNGTGDHLN
GTVKADKQEWNGREYSIEFTLPPLATVVFRLG
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtaatccaacacagcctttttactgactacgacatatatttattcaagtcg
gggacacactttcggatttatgaaaaaatgggcagccatttgatcgaagtagagggtcaa
aaaggggtctatttttccgtttgggcacccaatgctcaaagtgtatccgtgattggaaat
ttcaatttttggaacacccaagaacatccgctctcgtcacgttgggatggctccgggatc
tgggagggttttattcctggtctggaaaaaggtacactgtacaaataccacattcatgcg
cagagtgggcaacacctggaaaaaggagacccttatgccttgttttgggaagtacctccc
aaaactgcttccatcgtttgggacaacgactatacctggaatgaccaggattggttgaaa
aagagacaggaaaaagctggaaaaccacagccttattccgtgtatgaagtccacatgggc
acctggaagaagaacggcaacgagtccttgagttaccgcgagctggccgaagatttggta
gactatttaaaggaaatgaactttacacacgtagagtttttgcccgtgatggagcacccc
tattttccttcctggggttaccaggttacggggtattttgccccgaccagccgtttcggc
accccccaagacttcatgtatttggtggacaaactgcaccaggctggaatcggaatttta
ttggactgggttccctcccacttccctaccgatgcgcatggtttggccgagtttgacggt
acgtacctgtacgagcactccgacccccgcaagggtttccaccccgattggaaaagtgcg
atctacaactttgggcgcaacgaagtgcgcaacttcctgacctccaatgccctgtactgg
cttgatcgcttccacatcgatggtttgcgggtagatgccgttgcttcgatgctttacctc
gattattccagagaggaaggcgaatggattcccaatgaacaagggggcaaagaaaacctc
gacgctatctcgttcctgcgcgaattcaataccatgacttaccgggaattcccggatgtg
atcaccattgcggaagaatctaccgcctggtcgggggtctctcaccccacttatgcaggc
ggtttgggttttggacaaaaatggatgatgggttggatgcacgataccctcgactatttc
aataaagacacgatccaccgcaaataccaccacggggaaattacctttagtttgatttac
gcctttaccgaaaacttcatgttgccgctttcgcacgacgaagtggtacacggcaaaggc
ccgctaatcgaccgcatgcccggtgacgaatggcaacgttttgccaacctccgtctgatg
tatggttacatgtacacccaccctggtacgaagctgctcttcatgggtggagaatttggc
caaaccacggaatggagcatcgaacggggcctggaatggtggttgttggagtttgggcca
cacaaaggggtacaagcctgggtgcgcgatctgaatgccttctactcggctcaacctgca
ctttacgaaaaacaattcagcaatgaaggttttgagtgggtagaacacggcgactgggaa
aacagcgtgctggcttacctgcgcaaaggggaaaaagcggaagagaaccttctggtggtg
tgcaatttcacacccgtaacgcgggaaggtttccgcgtgggcgttcctgctaaaggcaag
tggaaagaagtgctcaacagcgatgccaagatctacaacggcacgggagatcacctcaac
ggcaccgtaaaagcggacaaacaagagtggaacggtcgggaatactcgattgagtttacg
ctgccgccgctggcgacggtggtgtttcggttggggtaa

DBGET integrated database retrieval system