KEGG   Haliscomenobacter hydrossis: Halhy_2629Help
Entry
Halhy_2629        CDS       T01491                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Halhy_2629
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Halhy_2629
Enzymes [BR:hhy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Halhy_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3358050..3359360)
Genome map
AA seq 436 aa AA seqDB search
MTLDAFEVIGGQALSGEIVPQGAKNEALQVLCAPLLSSEKVTISNVPQIQDVVLLIELLE
GLGVKVERLNADTYVFQADDINMVYLNSAEFLNKASKIRGSVMLIGPLLARYGRAFLPKP
GGDKIGRRRLDTHFLGLQSLGAEFKFDADLNVYFVEARQLQGTYILMDEISVTGTANVVM
AAVLAKGTTTIYNAACEPYVQQLCKLLNRMGARISGVSSNMLIIEGVEALGGAEHRLLPD
MIEVGSFIGLAAMTQSDLTIKAAGVAELGIIPRVFERMGIELIIQGDDIRIPAHEHYEIQ
SFIDGSILTIYDAPWPGFTPDLMSIMLVVATQARGSVLIHQKMFESRLFFVDKLIDMGAQ
IILCDPHRATVIGLDRRQPLRGISMTSPDIRAGVALLIAALSAKGRSVIHNVNQIDRGYQ
FIEERLKNIGAQIARI
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgatgcttttgaagtcatcggaggccaagccctatccggtgaaattgtgccc
caaggggcaaaaaatgaagcgctacaagtactatgcgcacctttgctctcctccgaaaaa
gttaccatctccaatgtgccccaaatccaggatgttgtattgctcatcgagctactggaa
ggtttaggggtgaaagtggaaagactcaacgcggatacctatgtttttcaagccgacgac
atcaatatggtgtacctcaattcggcggaattcctcaataaagccagtaaaatcagggga
tcggtaatgctcattgggccattgcttgcccgatatggccgagcatttttgcccaaaccg
ggtggagacaaaattggtcgccgccgcttggatacgcactttctgggtttacaatcactc
ggtgccgaatttaaatttgatgccgatctcaatgtttattttgtggaggcccgccaactt
cagggcacctacattctcatggacgaaatttcggtaacgggtacggccaatgtggtcatg
gccgccgttctagccaaaggaaccacaaccatttacaacgcggcctgcgaaccttatgta
caacagttgtgcaagttgctcaaccgcatgggcgcacgcatcagcggtgtaagttccaac
atgttgatcatcgaaggggtagaagcattgggtggtgccgaacaccggctcctgccggat
atgatcgaagtgggtagctttatcggcctggcagccatgacccaatccgacctgaccatc
aaagccgctggagtagccgagctgggcatcataccccgggtattcgaacgaatggggatc
gagttgatcatccagggcgatgatattcgcattcccgcgcacgagcactacgagattcag
agcttcatcgatggctctatcctcaccatttatgatgcaccctggcctggcttcacgccc
gacctgatgagcatcatgctggtggtggctacccaggcgcgaggcagtgtgctgatccac
caaaagatgttcgaaagccgcctgttttttgtcgacaagttgatcgatatgggtgcccaa
atcatcctttgtgacccgcatcgggctaccgtgatcggtttggatcgccgtcagccacta
cggggcatttccatgacttcgccggatattcgcgccggagttgcgctgttgattgcggca
ctttcggccaaagggcggagcgtgatccacaatgtaaaccagattgaccggggttatcag
tttatcgaggaacgtttgaagaatattggggcgcagattgccaggatataa

DBGET integrated database retrieval system