KEGG   Haliscomenobacter hydrossis: Halhy_2892Help
Entry
Halhy_2892        CDS       T01491                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hhy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3674290..3676170
Genome map
AA seq 626 aa AA seqDB search
MCGITGIIQFGTSPSSMYAPLERMNQALAHRGPDDEGIWVEGPVALGHRRLSIIDLSSAG
HQPMQSPDGRYVLVFNGEIYNFRTLKAELKDYPFRSGSDTEVILAAYAQWGIDCLKKLNG
MYALALWDRQEQTLLLARDHLGIKPLYLYEAPQQILFASEVRSLLASGMVPRKINPAGIS
DYLRYQTVHAPQTMVQGVRMLEPGHYLLLSMDGRVEERAYWQPLGTTVPANKLDLASARQ
KVREALLTTIERQMIADVPFGAFLSGGIDSSSIVALMSQVSTTAVKTFSVTFAEEAFSEA
PFARMIAEKYQTEHHEIRLSPDDFLHTIPRALQAMDHVSGDGPNTYIVAGATRKAGIKMA
LSGLGGDELFAGYPIFGRSKSLERLGWLNVLPVGLRQILAGVLAQSSSKVAIRKVAEVLG
LPQIEPYGAYPLSRQSWPEMTIAQLAPGLEKTPNAVAAILEIIQALPGFDAAPLLSKISA
AEMSTYMQNILLRDSDQMSMAHALEVRVPFLDHELVDLVMGISDAVKLPGAGPKPLLVAA
MGEWLPDAIVNRPKMGFTLPYELWMKGALREFCAGHLAQLGERPFFAAAALQKLWQDFLR
GHPGVKWSHLWSLVVLDEWLENNGLH
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcattaccggaatcattcagtttggcacctctccaagttccatgtatgcacca
ttggagcgcatgaaccaggccttggcgcacaggggccctgatgatgagggtatttgggtc
gaaggccccgttgcgctggggcaccgccgcttgtcgatcatcgatttgtcgagtgccggg
caccagcccatgcaaagcccggatgggcgctacgtgttggtgttcaatggagagatttac
aattttcgtaccctcaaggctgaacttaaagactacccttttcgctcgggttcagatacc
gaagtgattctggcggcttacgcccaatggggtatagattgcctgaaaaaactcaacggt
atgtatgccttagcgttgtgggatcgccaggaacaaaccttgttgctggcccgcgaccat
ttgggcatcaaacctctgtacctgtacgaagcgccccaacagatcctgtttgcttcggaa
gtgcggtctctcctggcgagcggaatggtgccccgcaagatcaatccggcgggcatcagc
gattacctgcgttaccaaaccgtacacgcccctcaaaccatggtgcaaggggtgcgcatg
cttgaacccgggcattatttgctgctgagtatggatggcagggtggaagaacgggcatat
tggcagccattgggcactaccgttcctgccaacaagctcgatttggccagcgcccgccaa
aaagtacgcgaagctttgttaaccaccatcgaacgacaaatgattgccgatgttcccttt
ggcgcatttttgtcggggggcattgattccagttcgattgttgccctgatgagtcaggtc
agcactacggcggtcaaaaccttttcggtcacttttgccgaagaagcattcagcgaggca
ccctttgcccggatgattgctgaaaaataccaaaccgagcaccacgaaattcgcctgagc
cccgacgattttttgcataccattccccgggcactacaggccatggatcacgtcagtggc
gatgggccaaacacctacatcgtagcgggtgccacccgcaaagcgggcatcaaaatggct
ttgtcgggcctgggtggagatgagttgtttgcgggttaccccatttttgggcgcagcaaa
agtttggagcgcttgggatggctgaatgttttacctgtgggcctgcggcaaatactggcg
ggtgtattggcgcaaagcagctcaaaagtggccatccggaaagtagccgaagtgttgggg
ttgccccagattgagccttatggtgcttatccgctgtcgcggcaaagttggccagaaatg
accattgctcagttggcgccgggactggaaaaaacgcccaacgcggtggcggcaattttg
gaaataatccaggccttacctggatttgacgcagcgcctttgctcagcaaaatctcggca
gcggagatgagtacttacatgcagaatatcctcctgcgcgattcagaccaaatgagtatg
gcccatgcgctggaggtacgcgtgccatttttggatcatgaactggtagacttggtaatg
ggcatcagtgatgccgtaaaattgcccggcgctggcccaaaacctttgctggttgcggcc
atgggtgaatggttgccggatgcgatcgtaaaccgacctaagatgggctttaccttgcct
tacgagctgtggatgaagggggcattgcgcgaattttgtgcgggtcacctggcccaattg
ggtgagcggcccttttttgccgccgccgccctgcaaaaattgtggcaggatttcctgcgg
gggcatccgggcgtaaaatggtcacacctgtggtcattggtggtattggatgaatggctg
gaaaacaacggactgcattag

DBGET integrated database retrieval system