KEGG   Haliscomenobacter hydrossis: Halhy_2938Help
Entry
Halhy_2938        CDS       T01491                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halhy_2938
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halhy_2938
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halhy_2938
Enzymes [BR:hhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halhy_2938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3726464..3727825
Genome map
AA seq 453 aa AA seqDB search
MQNRKTLLTEQEIPDKWYNIVADMPNKPLPPLHPGTREPIGPEALAPLFPMELIKQEVST
DKWIPIPDAVRDIYTMWRPTPLYRAYALEKALDTPAKIYYKYEGVSPAGSHKPNTAVPQA
YYNKMEGVKRITTETGAGQWGSALSFACQHFGIECEVYMVKVSYDGKPYRKMMMNTWGAK
VYSSPTDHTQSGRQILAQDPNSPGSLGIAISEAVERAATDENTKYALGSVLNHVLMHQTI
IGLEAVEQMKKVGDMPDVVVAPFGGGSNFAGISFPFLRLNFDEGRNIRFVASEPASCPKL
TRGVFRYDFGDTVGMTPLLPMYTLGHNFVPAPIHAGGLRYHGAGVIVSQLLKDQLIEARA
HHQLECFEAGVLFAKTEGIIPAPEASHALATVFAEAQAAKEEGKSRTILFNLCGHGHFDL
QAYDDYFNNRLVKHEVTNEDIANSLATLDTPVI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcgcaaaactttattgaccgaacaggaaattccagacaagtggtacaatatc
gtggccgacatgcccaataaaccattgccacctttacatcctggcacccgggagccgatt
ggcccggaagcattggcccctctatttcccatggaactcatcaaacaggaagtaagtacc
gacaaatggatacccattccggatgcagtacgtgatatttacacgatgtggcggcctacg
ccgctttaccgtgcctacgccctggaaaaagcgctggatactccggcaaaaatctactac
aaatacgaaggcgtaagcccggctggttcacacaaaccgaatactgccgttccccaggcc
tattacaacaaaatggaaggggtgaaacgcatcactaccgaaaccggggccggacaatgg
ggcagcgccttgtcctttgcctgccaacatttcggcatcgagtgtgaggtgtacatggtt
aaggtcagctacgatggcaaaccctaccgcaaaatgatgatgaatacttggggggctaag
gtttactcttcacctaccgatcatacccaatctggacggcaaattttggctcaggatccc
aactctcccggtagtttgggaatcgccatctccgaagcggtagaacgcgccgccacggac
gaaaataccaagtacgccctcggcagtgtgctcaatcacgtactgatgcaccaaaccatc
atcggcttagaggccgtggaacaaatgaaaaaagtgggcgacatgcccgatgtggtggtg
gcaccttttgggggaggatccaattttgcgggtatttctttcccttttttgcgcctcaat
tttgatgaaggccgcaacatccgttttgtggccagcgaacccgcgtcttgtccaaaactg
acgcgtggggttttccgctatgatttcggcgacacggtggggatgacgccactgctgcca
atgtatacactggggcacaacttcgtaccagcgcccattcacgcgggtggcttgcgctac
cacggtgccggggtcatcgtgagccagttgctcaaagaccaattgatcgaagcgcgggcg
catcaccagctggagtgctttgaagcaggtgtgctttttgccaaaaccgaaggcatcatc
ccggctccggaagcaagtcatgcactagccaccgtatttgcggaggcgcaagcagccaaa
gaagaaggcaaatcgcgcacgatcttgttcaacctctgcggtcatgggcattttgacttg
caagcatatgatgattatttcaacaatcgcctggtgaagcacgaggtgacgaatgaggat
atcgcgaattcgttggcgactttggatacgccggtgatttag

DBGET integrated database retrieval system