KEGG   Haliscomenobacter hydrossis: Halhy_2992Help
Entry
Halhy_2992        CDS       T01491                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halhy_2992
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halhy_2992
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Halhy_2992
Enzymes [BR:hhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Halhy_2992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3793313..3794629
Genome map
AA seq 438 aa AA seqDB search
MLLYSTKNKNNQASLQEAVMKGLPDDNGLYMPEHIPQLDPEFIQNLANYSFLDIAHEVCT
TLFGDTIPEADLRIILENSMDFPAPVVKLDDQKYVLELFHGPSLAFKDFGARFMAQLMSY
FNRGETKELTILVATSGDTGGAVAAGFYKTPGIRVIILYPSGKVSMLQEKQLTTLGHNIS
ALEINGTFDDCQAMVKQAFLDSELTQKIRLSSANSINIARLIPQSFYYFEAYKQLPQSGD
PIVFCVPSGNFGNLTAGLLAAKMGLPVHRFIAATNANDVVPVYISDGTYQPRPSLRTLSN
AMDVGNPSNFARMLDLYLGTDERSTWNNIKNMVSGYAFDDAETAKVMQLVDQKYQYTLDP
HGAVGYLALDAYQQEHPNTRGIILETAHPAKFIDDVEEILGHKIEIPERLAELADREKKA
DYLEAEYGKLKAWLLEHS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgtacagcaccaaaaataaaaacaaccaagccagcttgcaggaggcagtcatg
aaaggattgcctgatgacaatggtttgtacatgcctgaacacatccctcaactcgatcca
gaatttattcaaaacctggccaattatagttttttggacattgctcatgaggtttgtact
accttatttggagacaccattcccgaagctgacctgcggatcatcctggaaaactccatg
gatttcccggcaccagtcgtcaaactcgatgaccagaagtatgttctggaacttttccat
ggtccttctttggcttttaaagattttggtgcccggtttatggctcaattgatgagctat
tttaaccgtggagaaacgaaagaactcaccattttggtggctacttcaggtgatacgggt
ggagcagttgccgcaggattttacaaaaccccgggcattcgggtgatcatcctctaccct
agcggcaaagtcagcatgctgcaagaaaaacaattgaccaccctgggacacaacatcagt
gcgctggagatcaacggtacttttgacgattgccaggctatggtcaaacaggcgtttttg
gactcggagctcacccagaaaatccggcttagttccgcaaactccatcaacattgctcgc
ctgattccccaatctttttattatttcgaagcttataaacaactgcctcaatcgggtgat
ccaatcgttttttgtgtacccagcggcaatttcggaaatttaaccgcggggcttttggca
gctaaaatgggtttaccagtacaccgttttatcgccgcaaccaatgccaatgatgtagtg
cctgtttatatttccgacggaacttatcagcctcgcccttcattacgtacactttccaat
gccatggatgtaggaaatccatccaattttgcccgtatgctcgatctttatttgggtaca
gatgaacgttccacgtggaacaatatcaaaaacatggtgagtggctatgcttttgacgat
gcggaaacagctaaagttatgcaattggtagatcaaaagtaccagtacactttggatcca
catggagcagtgggttatttggcgttggatgcatatcaacaagaacacccgaatacccgg
ggcattattttagaaaccgcgcatccagccaagtttattgatgatgtagaagagatactg
ggacataagattgagatcccggaacgattggccgagttggcagatcgggagaaaaaggcc
gattatttggaggcagaatatgggaaattgaaggcgtggttgctggagcatagctag

DBGET integrated database retrieval system