KEGG   Haliscomenobacter hydrossis: Halhy_3134Help
Entry
Halhy_3134        CDS       T01491                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Halhy_3134
  Lipid metabolism
   00561 Glycerolipid metabolism
    Halhy_3134
   00600 Sphingolipid metabolism
    Halhy_3134
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Halhy_3134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3964407..3966407
Genome map
AA seq 666 aa AA seqDB search
MKIQLNLTIICFLLLSTLSAQETRPIWLDDLPIKSFSEGIPAVLGKTNAAGDPLRIAGTT
YPHGVGVNSTSILAFYLNSHAQSFSALVGVDDEGNKTLPHKFYVIGDRKILFESREMKWG
DPAQKVEVDLQGIKRLGLLVKINDEGINRTYSNWADAKFVMLGNHLPENMPNTDEKYILT
PAPGKAPRINSPKVFGARPGNPFLYTIAATGQAPINYSAKNLPQGLRLDPKTGIITGSVA
QKSTHQSILRAKNKFGKATQRLTIKIGDTIALTPPIGWNGWNSWARNIDQEKVIASADAM
VKMGLRQHGWTYINIDDAWQGQRGGPFNAIQPNEKFPDFKGMVDYIHSLGLKVGIYSTPM
ITSYAGYTGGSSNFEKGELPDSIIQNKRAYRYVGKYRFERNDARQMAAWGIDYLKYDWRI
EVESAERMSAALQQSGRDIFYSISNSAPFAKVKDWVRLTNSWRTGPDIRDSWHSLYVSAF
TLDKWAPYGGPGHWNDPDMMILGNVTTGSPVHPTRLTPDEQYSHVSLFSLLSAPLLIGCP
IEQLDAFTLNLLTNDEVIAIDQDPLGKPARLIATENGVQIWLKSLADGSYALGLFNVGDF
GQTPQSYFRWDDEQPLNFTLDLTKLGLNEKYQLRDVWRQKDLGGFSGKFQAAIPHHGVVM
LKIIAN
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacaactgaatctgaccatcatctgcttccttctcctgagcacgctttccgct
caggaaacccgccccatttggctggatgacctccccatcaaatccttctccgaaggaatc
cccgccgtattaggcaaaaccaacgccgctggcgatcctctgcgcatcgctggaaccacc
tacccgcacggtgtcggcgtaaattccaccagcattcttgccttttacctgaatagccac
gcccaatccttttcggcactagtcggcgtcgacgacgagggcaacaaaaccctgccccac
aaattctacgtcatcggcgaccgcaaaatcctctttgaaagccgcgaaatgaaatggggc
gatccagcccaaaaagttgaagttgatctccaggggataaaacgcttgggattgctggtg
aaaatcaacgatgaaggcatcaatcgaacctacagcaattgggccgatgcaaaattcgtg
atgttgggcaaccacctgcctgaaaacatgcccaataccgacgaaaaatacattttgacc
cccgccccgggcaaggccccccgcatcaattcacccaaagtatttggcgcccgacccggc
aatccgttcctgtacaccattgccgccaccgggcaagcaccaataaattattcggctaaa
aacctgccgcaaggactcagactggatcctaaaaccggcatcatcaccggaagtgtagcg
caaaaaagcacgcatcaaagtatcctcagggcaaaaaacaaatttggcaaagctacccaa
cgattgaccatcaaaattggcgacaccatcgccctgacaccccccatcggttggaacggc
tggaactcctgggcacgcaacatcgatcaggaaaaagtaatcgcctctgcggacgccatg
gtaaaaatgggcttgcgccaacacggctggacctacatcaacatcgacgacgcctggcaa
ggtcaacgcggcggaccattcaacgccattcagcccaatgaaaaattccctgactttaaa
ggaatggtcgactacatccacagcctggggctaaaagtgggcatttattccacccccatg
atcaccagttatgcagggtacacgggtggctcttccaattttgaaaaaggagaattgccc
gattccatcatacaaaacaaacgcgcctaccgctacgtcggaaaataccgttttgaacgc
aacgatgcccgtcaaatggccgcatggggaatcgattatttaaagtacgactggcggatt
gaggtggaatcggctgaacggatgtccgccgcacttcaacaatcggggcgcgacattttt
tacagcatttccaattctgcacctttcgccaaggtcaaagactgggtgcgtttgaccaat
tcctggcgtaccggacccgatatccgcgactcctggcacagcctctacgtgtcggctttt
accctggataaatgggcaccctacggtggccccggccactggaacgaccccgacatgatg
atcctgggcaacgtaacgactggctcacccgtacatccgactcggctcacccccgacgaa
cagtacagccatgtgagtttgtttagcctgctttcggctcctttgctcatcggctgcccc
atcgaacaattggatgctttcaccctgaatctgctgaccaacgatgaggtcattgcaatc
gatcaagacccgttgggtaaacccgcccgcctgattgcaacggaaaatggggtgcaaatt
tggctcaaatcgttggcagatggctcctatgctctgggcttgttcaacgtcggcgacttt
ggccaaacgccacaatcttacttccgctgggacgacgaacagcctctaaactttaccctc
gatttaaccaaattgggtctgaacgaaaaataccaactgcgggatgtatggcggcaaaaa
gaccttggtgggttcagcggaaagtttcaggctgctattccgcaccacggtgtggtgatg
ctgaagataatcgctaactga

DBGET integrated database retrieval system