KEGG   Haliscomenobacter hydrossis: Halhy_3134Help
Entry
Halhy_3134        CDS       T01491                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hhy00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hhy00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hhy00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3964407..3966407
Genome map
AA seq 666 aa AA seqDB search
MKIQLNLTIICFLLLSTLSAQETRPIWLDDLPIKSFSEGIPAVLGKTNAAGDPLRIAGTT
YPHGVGVNSTSILAFYLNSHAQSFSALVGVDDEGNKTLPHKFYVIGDRKILFESREMKWG
DPAQKVEVDLQGIKRLGLLVKINDEGINRTYSNWADAKFVMLGNHLPENMPNTDEKYILT
PAPGKAPRINSPKVFGARPGNPFLYTIAATGQAPINYSAKNLPQGLRLDPKTGIITGSVA
QKSTHQSILRAKNKFGKATQRLTIKIGDTIALTPPIGWNGWNSWARNIDQEKVIASADAM
VKMGLRQHGWTYINIDDAWQGQRGGPFNAIQPNEKFPDFKGMVDYIHSLGLKVGIYSTPM
ITSYAGYTGGSSNFEKGELPDSIIQNKRAYRYVGKYRFERNDARQMAAWGIDYLKYDWRI
EVESAERMSAALQQSGRDIFYSISNSAPFAKVKDWVRLTNSWRTGPDIRDSWHSLYVSAF
TLDKWAPYGGPGHWNDPDMMILGNVTTGSPVHPTRLTPDEQYSHVSLFSLLSAPLLIGCP
IEQLDAFTLNLLTNDEVIAIDQDPLGKPARLIATENGVQIWLKSLADGSYALGLFNVGDF
GQTPQSYFRWDDEQPLNFTLDLTKLGLNEKYQLRDVWRQKDLGGFSGKFQAAIPHHGVVM
LKIIAN
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacaactgaatctgaccatcatctgcttccttctcctgagcacgctttccgct
caggaaacccgccccatttggctggatgacctccccatcaaatccttctccgaaggaatc
cccgccgtattaggcaaaaccaacgccgctggcgatcctctgcgcatcgctggaaccacc
tacccgcacggtgtcggcgtaaattccaccagcattcttgccttttacctgaatagccac
gcccaatccttttcggcactagtcggcgtcgacgacgagggcaacaaaaccctgccccac
aaattctacgtcatcggcgaccgcaaaatcctctttgaaagccgcgaaatgaaatggggc
gatccagcccaaaaagttgaagttgatctccaggggataaaacgcttgggattgctggtg
aaaatcaacgatgaaggcatcaatcgaacctacagcaattgggccgatgcaaaattcgtg
atgttgggcaaccacctgcctgaaaacatgcccaataccgacgaaaaatacattttgacc
cccgccccgggcaaggccccccgcatcaattcacccaaagtatttggcgcccgacccggc
aatccgttcctgtacaccattgccgccaccgggcaagcaccaataaattattcggctaaa
aacctgccgcaaggactcagactggatcctaaaaccggcatcatcaccggaagtgtagcg
caaaaaagcacgcatcaaagtatcctcagggcaaaaaacaaatttggcaaagctacccaa
cgattgaccatcaaaattggcgacaccatcgccctgacaccccccatcggttggaacggc
tggaactcctgggcacgcaacatcgatcaggaaaaagtaatcgcctctgcggacgccatg
gtaaaaatgggcttgcgccaacacggctggacctacatcaacatcgacgacgcctggcaa
ggtcaacgcggcggaccattcaacgccattcagcccaatgaaaaattccctgactttaaa
ggaatggtcgactacatccacagcctggggctaaaagtgggcatttattccacccccatg
atcaccagttatgcagggtacacgggtggctcttccaattttgaaaaaggagaattgccc
gattccatcatacaaaacaaacgcgcctaccgctacgtcggaaaataccgttttgaacgc
aacgatgcccgtcaaatggccgcatggggaatcgattatttaaagtacgactggcggatt
gaggtggaatcggctgaacggatgtccgccgcacttcaacaatcggggcgcgacattttt
tacagcatttccaattctgcacctttcgccaaggtcaaagactgggtgcgtttgaccaat
tcctggcgtaccggacccgatatccgcgactcctggcacagcctctacgtgtcggctttt
accctggataaatgggcaccctacggtggccccggccactggaacgaccccgacatgatg
atcctgggcaacgtaacgactggctcacccgtacatccgactcggctcacccccgacgaa
cagtacagccatgtgagtttgtttagcctgctttcggctcctttgctcatcggctgcccc
atcgaacaattggatgctttcaccctgaatctgctgaccaacgatgaggtcattgcaatc
gatcaagacccgttgggtaaacccgcccgcctgattgcaacggaaaatggggtgcaaatt
tggctcaaatcgttggcagatggctcctatgctctgggcttgttcaacgtcggcgacttt
ggccaaacgccacaatcttacttccgctgggacgacgaacagcctctaaactttaccctc
gatttaaccaaattgggtctgaacgaaaaataccaactgcgggatgtatggcggcaaaaa
gaccttggtgggttcagcggaaagtttcaggctgctattccgcaccacggtgtggtgatg
ctgaagataatcgctaactga

DBGET integrated database retrieval system