KEGG   Haliscomenobacter hydrossis: Halhy_3175Help
Entry
Halhy_3175        CDS       T01491                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Halhy_3175
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Halhy_3175
Enzymes [BR:hhy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Halhy_3175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4018860..4019336
Genome map
AA seq 158 aa AA seqDB search
MDSIHRFKVEGIAGKKIDFADFKGKKILVVNVASECGYTPQYAQLQELYETYKEKLVIVG
LPSNDFGGQEPGSNASIANFCKMRYGVSFPMTTKVHIKGVEIHPLYHWLTHKSQNGVMDS
EVKWNFQKYLLNEDGQLIDTFPSSLSPLEEPLLSRISE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtggattcaattcatcgcttcaaagttgaaggcatcgcgggaaagaagatcgatttcgct
gattttaaaggcaagaaaatactcgtggtcaatgtagcttcagaatgtggctacacccca
caatatgcacaattgcaagagctctacgaaacttataaagaaaaattggtcatcgtgggg
ctaccctccaatgactttgggggacaagagcccggctctaatgcaagcatcgcaaatttt
tgtaaaatgcgttacggggttagtttccccatgaccaccaaagttcacataaagggtgta
gaaattcatcctttgtaccattggttgacccataaaagtcaaaatggcgtgatggattcg
gaggtcaaatggaattttcaaaaatacttgctgaacgaagatggtcaactcatcgatact
tttccttcctcacttagtccacttgaagagccccttctaagtcggatcagtgaataa

DBGET integrated database retrieval system