KEGG   Haliscomenobacter hydrossis: Halhy_3215Help
Entry
Halhy_3215        CDS       T01491                                 

Definition
2-oxoglutarate dehydrogenase E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halhy_3215
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halhy_3215
  Amino acid metabolism
   00310 Lysine degradation
    Halhy_3215
Enzymes [BR:hhy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Halhy_3215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4063367..4064626)
Genome map
AA seq 419 aa AA seqDB search
MSVVELRVPSVGESINEVTLSRWLKEDGSFVKLDESLCEFESDKATLEFPSEATGKLIHV
AKEGDDLAIGALVAKIDTSVSAGESTPSTPPAETPVSTPAVSKPAEPAPSATSNYATGHP
SPAAGKILKENDIPATAVAGTGRDGRITKDDAVKAVENKVATPAAKVEAPAATPAAAPKA
KDVPAFSRDTERKKMTRMRRTIAKRLVSAKNETAMLTTFNEVDLTELMALREKYQDKFVA
KYGIKLGFMSLFAKACAKILLQMPEVNAMIDGEDFVYHNYADISFAISTPNGLVVPPIRN
VESLSFAEIEIELKNLAGKARNGTLTLEEMSGGTFTITNGGVFGSLLSTPIINEPQSAIL
GMHGIKNRPVAVGDKIEIRPMMYLALSYDHRVIDGSSSVTFLVKVKELLEDPIAMLLDI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagtagaattacgggttccctcagtgggcgaatccataaacgaagtaaccttg
tcccgttggttaaaagaagacgggtcatttgtcaaactcgacgaatcactttgtgaattt
gagtctgacaaagctacgctggaatttccctctgaagcgaccggaaaactgattcatgta
gccaaggaaggtgatgatttggccatcggtgccttggttgccaaaatagataccagcgta
agcgccggagaaagtacaccaagtacccctcctgccgaaacacccgtcagcactccagcg
gtgagcaaacccgctgaaccagcgccaagcgctacctccaattacgctacgggacatcct
tctcccgcagcaggcaaaattttgaaggaaaatgatattccggctactgcggttgccgga
acgggacgcgatgggcgcatcaccaaagacgatgccgtcaaggccgttgaaaacaaagtg
gctactcctgccgcaaaggttgaagcaccagcggcaacacccgctgctgcgcctaaagcc
aaggatgtgcccgcattttctcgcgataccgagcgcaaaaaaatgacccgcatgcgccgc
accatcgccaaacgtttggtaagtgccaaaaacgaaacggcgatgctcaccaccttcaac
gaggtagacttgaccgaattgatggcgctgcgcgaaaaataccaggacaaatttgtggcc
aaatacggcatcaaactgggcttcatgtccctgtttgccaaagcttgtgccaaaatttta
ttgcaaatgcccgaagtcaatgccatgatcgatggcgaagatttcgtttaccacaactac
gcggatatttcctttgcgatttctacgccaaatggattggtggtaccgccgattcgcaac
gtagagtctttgagttttgccgaaattgaaattgaactcaaaaacctggctggcaaagcc
cgcaatgggaccctcacccttgaagaaatgagtggcggcacctttaccattaccaacggc
ggggtatttggatctttgctcagcacccccatcatcaatgagccacaatcagcgatcctg
ggtatgcacggcatcaagaaccgtccggttgcggtaggagataaaatcgaaattcgtcca
atgatgtacctggccctgtcttacgaccaccgggtgatcgatggcagttcttcggtgact
tttttggtcaaagtgaaagagttactggaagacccaatcgcgatgttgctggatatttaa

DBGET integrated database retrieval system